LXL04_014844 | RubberDandelionOmics

Gene overview

LXL04_014844

Reference: OH-1004 Chr: Chr03 Coordinates: 57920446-57927035 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

4209 bp · LXL04_014844|LXL04_014844|OH1004|cDNA

ATGGGTCATATGGCGGGAATCGGCGGCTTCCAAGATGAGTTGAGCCGGAGTAAGCAACGAGAGGAGTTGGTTGAGAGAGCCATGGCGTTTGTAAAAGAAGATCATGAGAAGTTTTTGAAAAGATTAAAAGAACGCATAGATAGGGTAGGAATCGAGACACCAAAGATTGAAGTAAAGTACGAGAATTTATCAGTGGAAGGCGATGTTTATGTTGGTGATAGAGCTCTTCCGTCTCTCTTTAATACAATCTTCAACTCAAT...

CDS

Download CDS FASTA

4209 bp · LXL04_014844|LXL04_014844|OH1004|CDS

ATGGGTCATATGGCGGGAATCGGCGGCTTCCAAGATGAGTTGAGCCGGAGTAAGCAACGAGAGGAGTTGGTTGAGAGAGCCATGGCGTTTGTAAAAGAAGATCATGAGAAGTTTTTGAAAAGATTAAAAGAACGCATAGATAGGGTAGGAATCGAGACACCAAAGATTGAAGTAAAGTACGAGAATTTATCAGTGGAAGGCGATGTTTATGTTGGTGATAGAGCTCTTCCGTCTCTCTTTAATACAATCTTCAACTCAAT...

Protein

Download Protein FASTA

1402 aa · LXL04_014844|LXL04_014844|OH1004|PROTEIN

MGHMAGIGGFQDELSRSKQREELVERAMAFVKEDHEKFLKRLKERIDRVGIETPKIEVKYENLSVEGDVYVGDRALPSLFNTIFNSIESVLGLIGIVPSKKRKVKILQSVSGIVKPSRLTLLLGPPGGGKTTLLLALAGKLGNDLKVSHFLRIKHSNFKNIISNQLNFAYGISKQVSGNVSYCGHQLFEFIPQRTCAYISPHSLHTGEMTVRETLDFSGRCLGIGARSRLLTDIIRKEKEAGIEPDTDIDAFMKATAVPG...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_014844`
TK1151 ID	TkA02G392430
OH-1004 ID	LXL04_014844
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	99.900
Protein coverage (%)	TK1151 99.302 / OH-1004 50.713 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_014844

Location Chr03:57920446-57927035 (+)

Description Similar to ABCG39: ABC transporter G family member 39

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g66950`	May be a general defense protein.	No verified direct reference in this release
`At2g36380`	May be a general defense protein.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os11g0587600`	May be a general defense protein.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_014844 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0000302 response to reactive oxygen species Biological Process

GO:0009914 hormone transport Biological Process

GO:0042908 xenobiotic transport Biological Process

GO:2000032 regulation of secondary shoot formation Biological Process

GO:0005739 mitochondrion Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0005524 ATP binding Molecular Function

GO:0016887 ATP hydrolysis activity Molecular Function

GO:0140359 ABC-type transporter activity Molecular Function

KEGG gene cross-reference

ath:AT1G66950

ath:AT2G36380

dosa:Os11g0587600

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.477

Rank 1 · LXL04_014844 · OH-1004

Endoplasmic reticulum0.206

Rank 2 · LXL04_014844 · OH-1004

Lysosome / Vacuole0.172

Rank 3 · LXL04_014844 · OH-1004

Cytoplasm0.124

Rank 4 · LXL04_014844 · OH-1004

Golgi apparatus0.105

Rank 5 · LXL04_014844 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF14510.12ABC_trans_N32-81 aa

PF00005.34ABC_tran107-317 aa

PF19055.7ABC2_membrane_7351-403 aa

PF01061.30ABC2_membrane472-684 aa

PF08370.17PDR_assoc694-755 aa

PF00005.34ABC_tran829-981 aa

PF19055.7ABC2_membrane_71010-1070 aa

PF01061.30ABC2_membrane1127-1339 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_014844	`PF14510.12`	ABC_trans_N	32	81	3.5e-08	34.4
LXL04_014844	`PF00005.34`	ABC_tran	107	317	4.4e-34	118.7
LXL04_014844	`PF19055.7`	ABC2_membrane_7	351	403	4.3e-17	62.8
LXL04_014844	`PF01061.30`	ABC2_membrane	472	684	9.5e-98	326.6
LXL04_014844	`PF08370.17`	PDR_assoc	694	755	4.4e-23	81.5
LXL04_014844	`PF00005.34`	ABC_tran	829	981	4.4e-34	118.7
LXL04_014844	`PF19055.7`	ABC2_membrane_7	1010	1070	4.3e-17	62.8
LXL04_014844	`PF01061.30`	ABC2_membrane	1127	1339	9.5e-98	326.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q7PC84`	Arabidopsis thaliana	ABC transporter G family member 39	64.910%	Swiss-Prot	strong database homology
`Q7PC87`	Arabidopsis thaliana	ABC transporter G family member 34	64.574%	Swiss-Prot	strong database homology
`Q8GU84`	Oryza sativa subsp. japonica	ABC transporter G family member 48	57.751%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card