TkA02G392060 | RubberDandelionOmics

Gene overview

TkA02G392060

Reference: TK1151 Chr: Chr02 Coordinates: 99640431-99641631 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

852 bp · TkA02G392060|TK1151|cDNA

ATGAAGACAGAAGGAGAAGATGCTCCTGTCCCCTCTTCATGTAATTATTTTACCAGAAATTTTATTCCGCACCGCAAAGCATACCGTCCATATTTTGTCAGACTCGCGATTCTATCTCAAGTCAACCACAAGAATCTTGTTCAACTTTTGGGTTGTTGTATTGAAGCTGAACAGCCATTGATGATCTACGAGTTCATTTCAAGGGGTACCCTTTATCATCACTTACATAACGAGCCCTCCAACTTTTTAAATTGGCAATT...

CDS

Download CDS FASTA

852 bp · TkA02G392060|TK1151|CDS

ATGAAGACAGAAGGAGAAGATGCTCCTGTCCCCTCTTCATGTAATTATTTTACCAGAAATTTTATTCCGCACCGCAAAGCATACCGTCCATATTTTGTCAGACTCGCGATTCTATCTCAAGTCAACCACAAGAATCTTGTTCAACTTTTGGGTTGTTGTATTGAAGCTGAACAGCCATTGATGATCTACGAGTTCATTTCAAGGGGTACCCTTTATCATCACTTACATAACGAGCCCTCCAACTTTTTAAATTGGCAATT...

Protein

Download Protein FASTA

283 aa · TkA02G392060|TK1151|PROTEIN

MKTEGEDAPVPSSCNYFTRNFIPHRKAYRPYFVRLAILSQVNHKNLVQLLGCCIEAEQPLMIYEFISRGTLYHHLHNEPSNFLNWQLRVKICLQTAEALAYLHNSAHTPIYHRDIKSTNILLDDEFNAKVSDFGLSRLARPGLSHVSTCAQGTLGYLDPEYYRNYQLTDKSDVYSFGVVLLEVLTTKKAIDFERGEEDVNLAVYVAQRATSVMEVVDRRLVGEDPPDQMVVSVIMFCKLALTCLRAKKGERPNMKEVVQE...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G392060`
TK1151 ID	TkA02G392060
OH-1004 ID	LXL04_014850
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	99.600
Protein coverage (%)	TK1151 87.986 / OH-1004 39.904 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G392060

Location Chr02:99640431-99641631 (+)

Description Similar to WAKL20: Wall-associated receptor kinase-like 20

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g02070`	Serine/threonine-protein kinase that may function as a signaling receptor of extracellular matrix component.	No verified direct reference in this release
`At3g53840`	Putative serine/threonine-protein kinase that may function as a signaling receptor of extracellular matrix component.	No verified direct reference in this release
`At1g69730`	Serine/threonine-protein kinase that may function as a signaling receptor of extracellular matrix component.	No verified direct reference in this release
`At5g66790`	Serine/threonine-protein kinase that may function as a signaling receptor of extracellular matrix component.	No verified direct reference in this release
`At2g23450`	Serine/threonine-protein kinase that may function as a signaling receptor of extracellular matrix component.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_014850 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006952 defense response Biological Process

GO:0007166 cell surface receptor signaling pathway Biological Process

GO:0009603 detection of symbiotic fungus Biological Process

GO:0009826 unidimensional cell growth Biological Process

GO:0034052 positive regulation of plant-type hypersensitive response Biological Process

GO:0045087 innate immune response Biological Process

GO:0048527 lateral root development Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009897 external side of plasma membrane Cellular Component

GO:0004674 protein serine/threonine kinase activity Molecular Function

KEGG gene cross-reference

ath:AT1G21210

ath:AT1G69730

ath:AT3G53840

ath:AT5G02070

zma:103645992

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.471

Rank 1 · TkA02G392060 · TK1151

Cytoplasm0.393

Rank 2 · TkA02G392060 · TK1151

Nucleus0.198

Rank 3 · TkA02G392060 · TK1151

Golgi apparatus0.066

Rank 4 · TkA02G392060 · TK1151

Endoplasmic reticulum0.064

Rank 5 · TkA02G392060 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF07714PK_Tyr_Ser-Thr35-261 aa

PF00069Pkinase35-259 aa

PF12330Haspin_kinase57-139 aa

PF03617IBV_3A66-75 aa

PF14531Kinase-like86-183 aa

PF25793WHD_2nd_NFRKB207-278 aa

PF03617IBV_3A227-270 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G392060	`PF07714`	PK_Tyr_Ser-Thr	35	261	3e-39	135.6
TkA02G392060	`PF00069`	Pkinase	35	259	4.8e-34	118.7
TkA02G392060	`PF12330`	Haspin_kinase	57	139	0.022	14.5
TkA02G392060	`PF03617`	IBV_3A	66	75	0.41	11.4
TkA02G392060	`PF14531`	Kinase-like	86	183	0.0042	17.1
TkA02G392060	`PF25793`	WHD_2nd_NFRKB	207	278	0.23	12.2
TkA02G392060	`PF03617`	IBV_3A	227	270	0.41	11.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LZM4`	Arabidopsis thaliana	sp\|Q9LZM4\|WAKLQ_ARATH Wall-associated receptor kinase-like 20	54.000%	Swiss-Prot	High
`Q9M342`	Arabidopsis thaliana	sp\|Q9M342\|WAKLP_ARATH Wall-associated receptor kinase-like 15	52.300%	Swiss-Prot	High
`Q9C9L5`	Arabidopsis thaliana	sp\|Q9C9L5\|WAKLH_ARATH Wall-associated receptor kinase-like 9	47.900%	Swiss-Prot	Medium
`Q8GYF5`	Arabidopsis thaliana	sp\|Q8GYF5\|WAKLR_ARATH Wall-associated receptor kinase-like 21	50.000%	Swiss-Prot	High
`Q8RY67`	Arabidopsis thaliana	sp\|Q8RY67\|WAKLO_ARATH Wall-associated receptor kinase-like 14	48.700%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card