TkA02G383610 | RubberDandelionOmics

Gene overview

TkA02G383610

Reference: TK1151 Chr: Chr02 Coordinates: 97493240-97494729 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1246 bp · TkA02G383610|TK1151|cDNA

TTCTAACACTTGATGTTGCAGAAGCTTTGTCAAAGCTTGAGCATCTTGCTGTTGATGAATGCGATAATATGGAAGAAATCATACATATTGAGAGTGGTAGAGAAGAGACAATTTCATTTCCTAAGTTGAATTCTCTATATTTGTACGACCTACCAAACCTATCGGGGTTGTGCGATAACGTCAACATGATTAAGCTACCACAACTAGTTGAGTTGTATCTTTATGGAATTCCAAATATCACAAGCATTTTTAGCATGAAT...

CDS

Download CDS FASTA

873 bp · TkA02G383610|TK1151|CDS

ATGGAAGAAATCATACATATTGAGAGTGGTAGAGAAGAGACAATTTCATTTCCTAAGTTGAATTCTCTATATTTGTACGACCTACCAAACCTATCGGGGTTGTGCGATAACGTCAACATGATTAAGCTACCACAACTAGTTGAGTTGTATCTTTATGGAATTCCAAATATCACAAGCATTTTTAGCATGAATAAGTTGGAAACATCTTGTGTCTTTAAAGGAGAGGTTGTGATTTCTAAGCTGGAGAAATTGTCTATTCT...

Protein

Download Protein FASTA

290 aa · TkA02G383610|TK1151|PROTEIN

MEEIIHIESGREETISFPKLNSLYLYDLPNLSGLCDNVNMIKLPQLVELYLYGIPNITSIFSMNKLETSCVFKGEVVISKLEKLSILNMENLNEIWSSEFPTRQEVQFREISVINCDKLVNLFPSNPMPLLHHLEELQVEECGAIEVLFNIDLDCVGEIGLEEGSTSSLKKIELKKLAKLREVWRIKSVNNSFLPFRGFQAVEHITIEICERFRNVFTPITTNFDLGALIEMKITIFGEAWSSNESVESSQKEAKRYGLE...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G383610`
TK1151 ID	TkA02G383610
OH-1004 ID	LXL04_014925
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	98.400
Protein coverage (%)	TK1151 87.241 / OH-1004 20.159 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA02G383610`
Location	Chr02:97493240-97494729 (-)
Description	Similar to RPS2: Disease resistance protein RPS2
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_014925` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0002220 innate immune response activating cell surface receptor signaling pathway Biological Process GO:0006952 defense response Biological Process GO:0009626 plant-type hypersensitive response Biological Process GO:0016045 detection of bacterium Biological Process GO:0042742 defense response to bacterium Biological Process GO:0098542 defense response to other organism Biological Process GO:2000377 regulation of reactive oxygen species metabolic process Biological Process GO:0005634 nucleus Cellular Component GO:0005737 cytoplasm Cellular Component GO:0005739 mitochondrion Cellular Component GO:0005886 plasma membrane Cellular Component GO:0005524 ATP binding Molecular Function
KEGG gene cross-reference	ath:AT1G12280 ath:AT1G61180 ath:AT4G26090 ath:AT4G27190 ath:AT4G27220 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.530

Rank 1 · TkA02G383610 · TK1151

Cytoplasm0.321

Rank 2 · TkA02G383610 · TK1151

Cell membrane0.173

Rank 3 · TkA02G383610 · TK1151

Endoplasmic reticulum0.083

Rank 4 · TkA02G383610 · TK1151

Lysosome / Vacuole0.032

Rank 5 · TkA02G383610 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF23247LRR_RPS24-63 aa

PF25019LRR_R13L1-DRL2115-52 aa

PF12799LRR_416-30 aa

PF12799LRR_418-60 aa

PF25019LRR_R13L1-DRL2175-95 aa

PF12799LRR_478-95 aa

PF25019LRR_R13L1-DRL2180-142 aa

PF23247LRR_RPS281-235 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G383610	`PF23247`	LRR_RPS2	4	63	2.4e-30	106.3
TkA02G383610	`PF25019`	LRR_R13L1-DRL21	15	52	0.066	13.8
TkA02G383610	`PF12799`	LRR_4	16	30	0.54	11.3
TkA02G383610	`PF12799`	LRR_4	18	60	0.54	11.3
TkA02G383610	`PF25019`	LRR_R13L1-DRL21	75	95	0.066	13.8
TkA02G383610	`PF12799`	LRR_4	78	95	0.54	11.3
TkA02G383610	`PF25019`	LRR_R13L1-DRL21	80	142	0.066	13.8
TkA02G383610	`PF23247`	LRR_RPS2	81	235	2.4e-30	106.3
TkA02G383610	`PF12799`	LRR_4	131	139	0.54	11.3
TkA02G383610	`PF25019`	LRR_R13L1-DRL21	167	183	0.066	13.8
TkA02G383610	`PF12799`	LRR_4	170	184	0.54	11.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card