RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

TkA02G379060
Reference: TK1151 Chr: Chr02 Coordinates: 96348526-96351346 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

2249 bp · TkA02G379060|TK1151|cDNA

ATCGTAGGATGTGTGTTGAACTTCACATCACTACCCTACCAACCAAACGGAGACTGCATAGACAGTGAACAGAAGCTCAAAATCAAAGCATGGGGAATTCTCCCAACAACCCTCTGTTGCCAATCCCCTCTAATCCTAATCTCCAAATCCCTCGCTCGATTATCCTCCAATTCATCAACCCCCTCAATCTTTCCCCCTTCCAATCAATGGTCACACTGTAACGACCCTTCAATCTTCAAATCCCAACATGATTCCGTCAA...

CDS

Download CDS FASTA

1740 bp · TkA02G379060|TK1151|CDS

ATCGTAGGATGTGTGTTGAACTTCACATCACTACCCTACCAACCAAACGGAGACTGCATAGACAGTGAACAGAAGCTCAAAATCAAAGCATGGGGAATTCTCCCAACAACCCTCTGTTGCCAATCCCCTCTAATCCTAATCTCCAAATCCCTCGCTCGATTATCCTCCAATTCATCAACCCCCTCAATCTTTCCCCCTTCCAATCAATGGTCACACTGTAACGACCCTTCAATCTTCAAATCCCAACATGATTCCGTCAA...

Protein

Download Protein FASTA

579 aa · TkA02G379060|TK1151|PROTEIN

IVGCVLNFTSLPYQPNGDCIDSEQKLKIKAWGILPTTLCCQSPLILISKSLARLSSNSSTPSIFPPSNQWSHCNDPSIFKSQHDSVNFDDCNFKNFFKEAMLCSGLSVADLKKDQTFNDASATCGQFEQSNAPFDDICRNCSRAVLKARDSVAKGLGVSGNQTEVEICGIAVVTGLASLKWNDSSLAAVDDVYGCLRILDVHDPGYIKLKHSIFQTLLGVVLASMGLMLVIMLVKYVTRKKQQENKSSQFHTKEIPTAWS...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDTkA02G379060
TK1151 IDTkA02G379060
OH-1004 IDLXL04_024114
Relationship / confidenceNon Reciprocal Best Hit / Complex relationship
Protein identity (%)36.500
Protein coverage (%)TK1151 76.684 / OH-1004 76.736
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionTK1151 / GWHBCHF00000000
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDTkA02G379060
LocationChr02:96348526-96351346 (+)
DescriptionSimilar to NORK: Nodulation receptor kinase
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
At5g49770 Probable leucine-rich repeat receptor-like protein kinase At5g49770. No verified direct reference in this release
At1g68690 Could be involved in the negative regulation of root growth. No verified direct reference in this release
At5g28680 Receptor-like protein kinase that controls pollen tube behavior by directing rupture at proper timing to release the sperm cell. No verified direct reference in this release
At5g49760 Leucine-rich repeat receptor protein kinase that acts as sensor of extracellular hydrogen peroxide.
Hydrogen peroxide sensor HPCA1 is an LRR receptor kinase in Arabidopsis.2020 · DOI: 10.1038/s41586-020-2032-3
At2g42960 Probable receptor-like protein kinase At2g42960. No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_024114 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)
GO:0009877 nodulation Biological Process
GO:0046777 protein autophosphorylation Biological Process
GO:0005737 cytoplasm Cellular Component
GO:0005829 cytosol Cellular Component
GO:0005886 plasma membrane Cellular Component
GO:0009507 chloroplast Cellular Component
GO:0016020 membrane Cellular Component
GO:0004672 protein kinase activity Molecular Function
GO:0004674 protein serine/threonine kinase activity Molecular Function
GO:0005524 ATP binding Molecular Function
GO:0106310 protein serine kinase activity Molecular Function
KEGG gene cross-reference
ath:AT2G42960
ath:AT5G18500
mtr:11407326
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.870
Rank 1 · TkA02G379060 · TK1151
Cytoplasm0.085
Rank 2 · TkA02G379060 · TK1151
Endoplasmic reticulum0.078
Rank 3 · TkA02G379060 · TK1151
Nucleus0.056
Rank 4 · TkA02G379060 · TK1151
Lysosome / Vacuole0.024
Rank 5 · TkA02G379060 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00899ThiF34-254 aa
PF12330Haspin_kinase80-112 aa
PF22870YibX83-99 aa
PF22870YibX126-152 aa
PF02790COX2_TM208-259 aa
PF07714PK_Tyr_Ser-Thr209-242 aa
PF00069Pkinase224-254 aa
PF26599MntS227-247 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
TkA02G379060PF00899ThiF342540.08912.7
TkA02G379060PF12330Haspin_kinase801120.1611.6
TkA02G379060PF22870YibX83990.4711.5
TkA02G379060PF22870YibX1261520.4711.5
TkA02G379060PF02790COX2_TM2082590.1213.3
TkA02G379060PF07714PK_Tyr_Ser-Thr2092425.6e-43147.8
TkA02G379060PF00069Pkinase2242544.3e-45154.9
TkA02G379060PF26599MntS2272470.02514.8
TkA02G379060PF00069Pkinase2795354.3e-45154.9
TkA02G379060PF03109ABC12793071.8e-0524.7
TkA02G379060PF07714PK_Tyr_Ser-Thr2804715.6e-43147.8
TkA02G379060PF22870YibX3313550.4711.5
TkA02G379060PF03109ABC13424331.8e-0524.7
TkA02G379060PF17667Pkinase_fungal3744603e-0523.7
TkA02G379060PF12330Haspin_kinase3954330.1611.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
Q9LT96Arabidopsis thalianasp|Q9LT96|Y5977_ARATH Probable leucine-rich repeat receptor-like protein kinase At5g4977038.500%Swiss-ProtLow
Q9SX31Arabidopsis thalianasp|Q9SX31|PERK9_ARATH Proline-rich receptor-like protein kinase PERK939.000%Swiss-ProtLow
Q3E8W4Arabidopsis thalianasp|Q3E8W4|ANX2_ARATH Receptor-like protein kinase ANXUR239.200%Swiss-ProtLow
Q8GZ99Arabidopsis thalianasp|Q8GZ99|HPCA1_ARATH Leucine-rich repeat receptor protein kinase HPCA135.600%Swiss-ProtMedium
Q9SJG2Arabidopsis thalianasp|Q9SJG2|Y2296_ARATH Probable receptor-like protein kinase At2g4296038.200%Swiss-ProtLow

JBrowse

View in Genome Browser