TkA02G371930 | RubberDandelionOmics

Gene overview

TkA02G371930

Reference: TK1151 Chr: Chr02 Coordinates: 94673378-94676630 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2110 bp · TkA02G371930|TK1151|cDNA

GTCAAATGTGATCATGGAAGAACTTTCTCAGCATCTTCCTCTGTTTCTAGTAAACGGGCAGCGAAGTCGTACAACCAGTCTCTTTCTAGCTATGATCAAAGGAATCGAACACTCTTCATTCATCGTCATCTTCGTACCCTCTTTCTCTATCTCTACACATAGTTCATAAAATCGGATATTAGAGATAGAAGGATATGGCCCCCGGTGACGAAGAAGATCACTCTCAATTGAAGGGATTCGTTTTCATCACTCTCCCTCCG...

CDS

Download CDS FASTA

1422 bp · TkA02G371930|TK1151|CDS

ATGGCCCCCGGTGACGAAGAAGATCACTCTCAATTGAAGGGATTCGTTTTCATCACTCTCCCTCCGCCAGACAACCCTTCTCTAGGCAAAACCATCACAGCTATCACCCTCTCCAACCAACCAAATCCTCCACCACAACAACCACCACCACCACTACCATCGTCAGCACCACTTTCCCACCTTCCGATCTCATTACCTCATACGCGAAGAACCTTTTTCGAACACCCAAGACGAAGAATCTCTTGGACTCTTACGGGTGT...

Protein

Download Protein FASTA

473 aa · TkA02G371930|TK1151|PROTEIN

MAPGDEEDHSQLKGFVFITLPPPDNPSLGKTITAITLSNQPNPPPQQPPPPLPSSAPLSHLPISLPHTRRTFFEHPRRRISWTLTGVALFALLTLCSLQSPQSLLKLSSSGSLDKPDQNDEDDKKPNSFIFPLYPKSGFGGMSKSRDMEVKLGKFTMLSSKSAVLPVDDGGLPSKLTVSKTAVLPINGDNFVDGLYYTQIHVGSPPRPYFLDIDTGSDLTWIQCDAPCASCAKGAHPYYKPAKGNLLSQKDPFCYDFHHT...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G371930`
TK1151 ID	TkA02G371930
OH-1004 ID	LXL04_010218
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	43.000
Protein coverage (%)	TK1151 61.522 / OH-1004 67.453 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G371930

Location Chr02:94673378-94676630 (+)

Description Similar to ASP1: Aspartic proteinase Asp1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g49050`	Involved in proteolytic processing of BAG6 and plant basal immunity.	Aspartyl Protease-Mediated Cleavage of BAG6 Is Necessary for Autophagy and Fungal Resistance in Plants.2016 · DOI: 10.1105/tpc.15.00626
`At1g65240`	Displays aspartic proteolytic activity.	No verified direct reference in this release
`At5g36260`	Displays aspartic proteolytic activity.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os11g0184800`	Aspartic proteinase Asp1.	No verified direct reference in this release
`UniProt: A2ZC67`	Possesses protease activity in vitro.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_010218 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006508 proteolysis Biological Process

GO:0009555 pollen development Biological Process

GO:0009846 pollen germination Biological Process

GO:0009860 pollen tube growth Biological Process

GO:0010183 pollen tube guidance Biological Process

GO:0030163 protein catabolic process Biological Process

GO:0050832 defense response to fungus Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0016020 membrane Cellular Component

KEGG gene cross-reference

ath:AT1G49050

ath:AT1G65240

ath:AT5G36260

dosa:Os11g0184800

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.322

Rank 1 · TkA02G371930 · TK1151

Endoplasmic reticulum0.190

Rank 2 · TkA02G371930 · TK1151

Extracellular0.162

Rank 3 · TkA02G371930 · TK1151

Lysosome / Vacuole0.160

Rank 4 · TkA02G371930 · TK1151

Cytoplasm0.130

Rank 5 · TkA02G371930 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF14543TAXi_N196-370 aa

PF00026Asp196-441 aa

PF14541TAXi_C392-465 aa

PF30420AtoS_N403-449 aa

PF14543TAXi_N418-433 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G371930	`PF14543`	TAXi_N	196	370	7.2e-49	167.1
TkA02G371930	`PF00026`	Asp	196	441	1.2e-16	61.7
TkA02G371930	`PF14541`	TAXi_C	392	465	0.0016	19.0
TkA02G371930	`PF30420`	AtoS_N	403	449	0.31	11.4
TkA02G371930	`PF14543`	TAXi_N	418	433	7.2e-49	167.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9M9A8`	Arabidopsis thaliana	sp\|Q9M9A8\|APCB1_ARATH Aspartyl protease APCB1	43.700%	Swiss-Prot	Medium
`Q9S9K4`	Arabidopsis thaliana	sp\|Q9S9K4\|ASP39_ARATH Aspartic proteinase 39	33.800%	Swiss-Prot	Medium
`Q4V3D2`	Arabidopsis thaliana	sp\|Q4V3D2\|ASP36_ARATH Aspartic proteinase 36	29.800%	Swiss-Prot	Low
`Q0IU52`	Oryza sativa subsp. japonica	sp\|Q0IU52\|ASP1_ORYSJ Aspartic proteinase Asp1	38.300%	Swiss-Prot	Medium
`A2ZC67`	Oryza sativa subsp. indica	sp\|A2ZC67\|ASP1_ORYSI Aspartic proteinase Asp1	35.800%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card