TkA02G368030 | RubberDandelionOmics

Gene overview

TkA02G368030

Reference: TK1151 Chr: Chr02 Coordinates: 93657675-93660507 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1816 bp · TkA02G368030|TK1151|cDNA

GGAGGAGTATATCGTAGATCTAAGGAGCCACAGAAGAAATAAAAGAGACCATCTGAAGTCTGAACTCCTGATTCAAAAGAATCAAAGCAAGTACCTGTCCCGAGTTTCCACCCAACCACAGACTCACCTTGATCTCACCGTCAATCAACAATGTCCTTCGCCGTTAACCCACCGCCGGCTGTCCGACACTTCCCATTCTCCCGGTCAACCGTCGTCCGCACGCCACGCGTCTCCATGGTCGCCCGATCCAACACCGGTGT...

CDS

Download CDS FASTA

1500 bp · TkA02G368030|TK1151|CDS

ATGTCCTTCGCCGTTAACCCACCGCCGGCTGTCCGACACTTCCCATTCTCCCGGTCAACCGTCGTCCGCACGCCACGCGTCTCCATGGTCGCCCGATCCAACACCGGTGTCTCAGTCTCCACCGCTGCCGCACTCCCTATATTAACCAAGTTAAAAAATGATTGCGCCACCCCTCTCCCCGTCCTCCGCCACATTGCCGACGCCATGGCAACTCATATGCGAGCTGGCCTCTCAGTTGATGGCGGCAGTGATCTCAAGAT...

Protein

Download Protein FASTA

499 aa · TkA02G368030|TK1151|PROTEIN

MSFAVNPPPAVRHFPFSRSTVVRTPRVSMVARSNTGVSVSTAAALPILTKLKNDCATPLPVLRHIADAMATHMRAGLSVDGGSDLKMILSYVDSLPTGNERGLFYALDLGGTNFRVLRTQLGGKDERVIDTECEQVSIPQDIMFGTSEELFDFIASALANFVKKEGGKFVLPNDRSRETGFTFSFPVKQTSIDSGILIKWTKGFAVSGTPGKDIVACLNEAMRRQGLNMRVSALVNDTVATLAGARYWDDDVMVAVILGT...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G368030`
TK1151 ID	TkA02G368030
OH-1004 ID	LXL04_015104
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	98.200
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G368030

Location Chr02:93657675-93660507 (+)

Description Similar to HXK2: Hexokinase-2, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g47840`	Fructose and glucose phosphorylating enzyme.	No verified direct reference in this release
`At4g29130`	Fructose and glucose phosphorylating enzyme.	Role of the Arabidopsis glucose sensor HXK1 in nutrient, light, and hormonal signaling.2003 · DOI: 10.1126/science.1080585 Mitochondria-associated hexokinases play a role in the control of programmed cell death in Nicotiana benthamiana.2006 · DOI: 10.1105/tpc.106.041509 Cooperative control between AtRGS1 and AtHXK1 in a WD40-repeat protein pathway in Arabidopsis thaliana.2015 · DOI: 10.3389/fpls.2015.00851 Sugar and hexokinase suppress expression of PIP aquaporins and reduce leaf hydraulics that preserves leaf water potential.2017 · DOI: 10.1111/tpj.13568 The role of HEXOKINASE1 in Arabidopsis leaf growth.2019 · DOI: 10.1007/s11103-018-0803-0 Guard cells control hypocotyl elongation through HXK1, HY5, and PIF4.2021 · DOI: 10.1038/s42003-021-02283-y HEXOKINASE1 forms a nuclear complex with the PRC2 subunits CURLY LEAF and SWINGER to regulate glucose signaling.2022 · DOI: 10.1111/jipb.13261

Rice

Reference gene ID	Possible function	Papers / DOI
`Os07g0197100`	Fructose and glucose phosphorylating enzyme.	Structure, expression, and functional analysis of the hexokinase gene family in rice (Oryza sativa L.).2006 · DOI: 10.1007/s00425-006-0251-y

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_015104 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0001678 intracellular glucose homeostasis Biological Process

GO:0006006 glucose metabolic process Biological Process

GO:0006096 glycolytic process Biological Process

GO:0006357 regulation of transcription by RNA polymerase II Biological Process

GO:0010148 transpiration Biological Process

GO:0010182 sugar mediated signaling pathway Biological Process

GO:0010255 glucose mediated signaling pathway Biological Process

GO:0012501 programmed cell death Biological Process

GO:0019320 hexose catabolic process Biological Process

GO:0051156 glucose 6-phosphate metabolic process Biological Process

GO:0090332 stomatal closure Biological Process

GO:2000032 regulation of secondary shoot formation Biological Process

KEGG gene cross-reference

ath:AT1G47840

ath:AT4G29130

dosa:Os07g0197100

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.494

Rank 1 · TkA02G368030 · TK1151

Peroxisome0.184

Rank 2 · TkA02G368030 · TK1151

Plastid0.166

Rank 3 · TkA02G368030 · TK1151

Nucleus0.163

Rank 4 · TkA02G368030 · TK1151

Mitochondrion0.126

Rank 5 · TkA02G368030 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00349Hexokinase_148-247 aa

PF01120Alpha_L_fucos153-235 aa

PF03727Hexokinase_2254-492 aa

PF01120Alpha_L_fucos391-411 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G368030	`PF00349`	Hexokinase_1	48	247	1.8e-68	231.0
TkA02G368030	`PF01120`	Alpha_L_fucos	153	235	0.25	11.5
TkA02G368030	`PF03727`	Hexokinase_2	254	492	4.9e-81	272.4
TkA02G368030	`PF01120`	Alpha_L_fucos	391	411	0.25	11.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FZG4`	Arabidopsis thaliana	sp\|Q9FZG4\|HXKL1_ARATH Hexokinase-like 1 protein	64.500%	Swiss-Prot	High
`Q42525`	Arabidopsis thaliana	sp\|Q42525\|HXK1_ARATH Hexokinase-1	55.900%	Swiss-Prot	High
`Q6Z398`	Oryza sativa subsp. japonica	sp\|Q6Z398\|HXK4_ORYSJ Hexokinase-4, chloroplastic	72.700%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card