TkA02G344030 | RubberDandelionOmics

Gene overview

TkA02G344030

Reference: TK1151 Chr: Chr02 Coordinates: 87352132-87354074 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1280 bp · TkA02G344030|TK1151|cDNA

CGTCTCTCTCTGTCTCTCTCACTCACACACGCATACACACACTTCCAATACCTTTTCTCTCTATATAAACAGTCCTTCTTACCTAACGTAAAAGGCATCACCTTCTCAAAATACTATTCTCTCTTCCTCTGTCATCCATTTCTCTCTCTCTCTCACAAGGACAAGACACATAGATACATAAATCTGGCAATCAATCAATCCACAAAGATATCTAGAAAGTGCATGGACGTCGTTAATAGCAACAGTTGTACGATTGATAT...

CDS

Download CDS FASTA

1104 bp · TkA02G344030|TK1151|CDS

CGTCTCTCTCTGTCTCTCTCACTCACACACGCATACACACACTTCCAATACCTTTTCTCTCTATATAAACAGTCCTTCTTACCTAACGTAAAAGGCATCACCTTCTCAAAATACTATTCTCTCTTCCTCTGTCATCCATTTCTCTCTCTCTCTCACAAGGACAAGACACATAGATACATAAATCTGGCAATCAATCAATCCACAAAGATATCTAGAAAGTGCATGGACGTCGTTAATAGCAACAGTTGTACGATTGATAT...

Protein

Download Protein FASTA

367 aa · TkA02G344030|TK1151|PROTEIN

RLSLSLSLTHAYTHFQYLFSLYKQSFLPNVKGITFSKYYSLFLCHPFLSLSHKDKTHRYINLAINQSTKISRKCMDVVNSNSCTIDMSGGEEDDQMNMMMDDVRRGPWTVEEDFSLINYIAHHGEGRWNSVARCAGLKRTGKSCRLRWLNYLRPDVRRGNITLEEQLLILELHSRWGNRWSKIAQHLPGRTDNEIKNYWRTRVQKHAKQLKCDVNSKQFKDTMRYLWMPRLAERIDQAASTVTGDSSSLTTTNTCPLNAD...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G344030`
TK1151 ID	TkA02G344030
OH-1004 ID	LXL04_015358
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	99.700
Protein coverage (%)	TK1151 99.183 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G344030

Location Chr02:87352132-87354074 (+)

Description Similar to MYB78: Transcription factor MYB78

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g49620`	Transcription factor MYB78.	No verified direct reference in this release
`At3g06490`	Transcription factor contributing to the regulation of stamen maturation and male fertility in response to jasmonate signaling.	The BOTRYTIS SUSCEPTIBLE1 gene encodes an R2R3MYB transcription factor protein that is required for biotic and abiotic stress responses in Arabidopsis.2003 · DOI: 10.1105/tpc.014167 MYB108 acts together with MYB24 to regulate jasmonate-mediated stamen maturation in Arabidopsis.2009 · DOI: 10.1104/pp.108.132597 The Arabidopsis Botrytis Susceptible1 Interactor defines a subclass of RING E3 ligases that regulate pathogen and stress responses.2010 · DOI: 10.1104/pp.110.163915 Regulation of ABA dependent wound induced spreading cell death by MYB108.2013 · DOI: 10.1111/nph.12456
`At1g68320`	Transcription repressor of phosphate (Pi) starvation-induced genes.	Phosphate starvation responses and gibberellic acid biosynthesis are regulated by the MYB62 transcription factor in Arabidopsis.2009 · DOI: 10.1093/mp/ssn081

Rice

Reference gene ID	Possible function	Papers / DOI
`Os03g0315400`	Transcription factor involved in abiotic stress responses.	A R2R3-type MYB gene, OsMYB2, is involved in salt, cold, and dehydration tolerance in rice.2012 · DOI: 10.1093/jxb/err431
`Os11g0684000`	Jasmonate- (JA-) responsive transcription factor that promotes AGO18, AGO1a and AGO1b expression by binding to AG-motif-like elements in their promoters.	A novel jasmonic acid-inducible rice myb gene associates with fungal infection and host cell death.2001 · DOI: 10.1094/mpmi.2001.14.4.527 Jasmonate Signaling Enhances RNA Silencing and Antiviral Defense in Rice.2020 · DOI: 10.1016/j.chom.2020.05.001

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_015358 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0006952 defense response Biological Process

GO:0009409 response to cold Biological Process

GO:0009620 response to fungus Biological Process

GO:0009686 gibberellin biosynthetic process Biological Process

GO:0009737 response to abscisic acid Biological Process

GO:0009740 gibberellic acid mediated signaling pathway Biological Process

GO:0009753 response to jasmonic acid Biological Process

GO:0010015 root morphogenesis Biological Process

GO:0010373 negative regulation of gibberellin biosynthetic process Biological Process

GO:0012501 programmed cell death Biological Process

KEGG gene cross-reference

ath:AT1G68320

ath:AT3G06490

ath:AT5G49620

dosa:Os03g0315400

dosa:Os11g0684000

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.934

Rank 1 · TkA02G344030 · TK1151

Cytoplasm0.131

Rank 2 · TkA02G344030 · TK1151

Cell membrane0.028

Rank 3 · TkA02G344030 · TK1151

Endoplasmic reticulum0.019

Rank 4 · TkA02G344030 · TK1151

Plastid0.015

Rank 5 · TkA02G344030 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF13921Myb_DNA-bind_622-37 aa

PF00249Myb_DNA-binding105-152 aa

PF23082Myb_DNA-binding_2107-135 aa

PF13921Myb_DNA-bind_6108-166 aa

PF23588HTH_CHD1_Hrp3108-138 aa

PF00249Myb_DNA-binding158-201 aa

PF13921Myb_DNA-bind_6162-204 aa

PF15963Myb_DNA-bind_7174-222 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G344030	`PF13921`	Myb_DNA-bind_6	22	37	3.2e-21	76.0
TkA02G344030	`PF00249`	Myb_DNA-binding	105	152	5.6e-36	123.1
TkA02G344030	`PF23082`	Myb_DNA-binding_2	107	135	0.24	12.3
TkA02G344030	`PF13921`	Myb_DNA-bind_6	108	166	3.2e-21	76.0
TkA02G344030	`PF23588`	HTH_CHD1_Hrp3	108	138	0.14	12.9
TkA02G344030	`PF00249`	Myb_DNA-binding	158	201	5.6e-36	123.1
TkA02G344030	`PF13921`	Myb_DNA-bind_6	162	204	3.2e-21	76.0
TkA02G344030	`PF15963`	Myb_DNA-bind_7	174	222	0.12	13.0
TkA02G344030	`PF23082`	Myb_DNA-binding_2	178	209	0.24	12.3
TkA02G344030	`PF15963`	Myb_DNA-bind_7	299	311	0.12	13.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FGY3`	Arabidopsis thaliana	sp\|Q9FGY3\|MYB78_ARATH Transcription factor MYB78	59.400%	Swiss-Prot	High
`Q9LDE1`	Arabidopsis thaliana	sp\|Q9LDE1\|MY108_ARATH Transcription factor MYB108	87.100%	Swiss-Prot	Low
`Q9C9G7`	Arabidopsis thaliana	sp\|Q9C9G7\|MYB62_ARATH Transcription factor MYB62	73.700%	Swiss-Prot	Low
`Q10MB4`	Oryza sativa subsp. japonica	sp\|Q10MB4\|MYB2_ORYSJ Transcription factor MYB2	87.300%	Swiss-Prot	Low
`Q2QZJ8`	Oryza sativa subsp. japonica	sp\|Q2QZJ8\|JAMYB_ORYSJ Transcription factor JAMYB	81.800%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card