LXL04_015358 | RubberDandelionOmics

Gene overview

LXL04_015358

Reference: OH-1004 Chr: Chr03 Coordinates: 69437396-69439162 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1104 bp · LXL04_015358|LXL04_015358|OH1004|cDNA

CGtctctctctgtctctctcACTCACACACGCATACACACACTTCCAATACCTTTTCTCTCTATATAAACAGTCCTTCTTACCTAACGTAAAAGGCATCACCTTCTCAAAATACTATTCTCTCTTCCTCTGTCATccatttctctctctctctcacaagGACAAGACACATAGATACATAAATCTGGCAATCAATCAATCCACAAAGATATCTAGAAAGTGCATGGACGTCGTTAATAGCAACAGTTGTACGATTGATAT...

CDS

Download CDS FASTA

1095 bp · LXL04_015358|LXL04_015358|OH1004|CDS

CTGTCTCTCTCACTCACACACGCATACACACACTTCCAATACCTTTTCTCTCTATATAAACAGTCCTTCTTACCTAACGTAAAAGGCATCACCTTCTCAAAATACTATTCTCTCTTCCTCTGTCATCCATTTCTCTCTCTCTCTCACAAGGACAAGACACATAGATACATAAATCTGGCAATCAATCAATCCACAAAGATATCTAGAAAGTGCATGGACGTCGTTAATAGCAACAGTTGTACGATTGATATGAGTGGTGG...

Protein

Download Protein FASTA

364 aa · LXL04_015358|LXL04_015358|OH1004|PROTEIN

MSLSLTHAYTHFQYLFSLYKQSFLPNVKGITFSKYYSLFLCHPFLSLSHKDKTHRYINLAINQSTKISRKCMDVVNSNSCTIDMSGGEEDDQMNMMMDDVRRGPWTVEEDFSLINYIAHHGEGRWNSVARCAGLKRTGKSCRLRWLNYLRPDVRRGNITLEEQLLILELHSRWGNRWSKIAQHLPGRTDNEIKNYWRTRVQKHAKQLKCDVNSKQFKDTMRYLWMPRLAERIDQAASTVTGDSSSLTTTNTCPLNADNID...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_015358`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_015358

Location Chr03:69437396-69439162 (-)

Description Similar to MYB78: Transcription factor MYB78

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g49620`	Transcription factor MYB78.	No verified direct reference in this release
`At3g06490`	Transcription factor contributing to the regulation of stamen maturation and male fertility in response to jasmonate signaling.	The BOTRYTIS SUSCEPTIBLE1 gene encodes an R2R3MYB transcription factor protein that is required for biotic and abiotic stress responses in Arabidopsis.2003 · DOI: 10.1105/tpc.014167 MYB108 acts together with MYB24 to regulate jasmonate-mediated stamen maturation in Arabidopsis.2009 · DOI: 10.1104/pp.108.132597 The Arabidopsis Botrytis Susceptible1 Interactor defines a subclass of RING E3 ligases that regulate pathogen and stress responses.2010 · DOI: 10.1104/pp.110.163915 Regulation of ABA dependent wound induced spreading cell death by MYB108.2013 · DOI: 10.1111/nph.12456
`At1g68320`	Transcription repressor of phosphate (Pi) starvation-induced genes.	Phosphate starvation responses and gibberellic acid biosynthesis are regulated by the MYB62 transcription factor in Arabidopsis.2009 · DOI: 10.1093/mp/ssn081

Rice

Reference gene ID	Possible function	Papers / DOI
`Os03g0315400`	Transcription factor involved in abiotic stress responses.	A R2R3-type MYB gene, OsMYB2, is involved in salt, cold, and dehydration tolerance in rice.2012 · DOI: 10.1093/jxb/err431
`Os11g0684000`	Jasmonate- (JA-) responsive transcription factor that promotes AGO18, AGO1a and AGO1b expression by binding to AG-motif-like elements in their promoters.	A novel jasmonic acid-inducible rice myb gene associates with fungal infection and host cell death.2001 · DOI: 10.1094/mpmi.2001.14.4.527 Jasmonate Signaling Enhances RNA Silencing and Antiviral Defense in Rice.2020 · DOI: 10.1016/j.chom.2020.05.001

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_015358 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0006952 defense response Biological Process

GO:0009409 response to cold Biological Process

GO:0009620 response to fungus Biological Process

GO:0009686 gibberellin biosynthetic process Biological Process

GO:0009737 response to abscisic acid Biological Process

GO:0009740 gibberellic acid mediated signaling pathway Biological Process

GO:0009753 response to jasmonic acid Biological Process

GO:0010015 root morphogenesis Biological Process

GO:0010373 negative regulation of gibberellin biosynthetic process Biological Process

GO:0012501 programmed cell death Biological Process

KEGG gene cross-reference

ath:AT1G68320

ath:AT3G06490

ath:AT5G49620

dosa:Os03g0315400

dosa:Os11g0684000

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.925

Rank 1 · LXL04_015358 · OH-1004

Cytoplasm0.143

Rank 2 · LXL04_015358 · OH-1004

Cell membrane0.027

Rank 3 · LXL04_015358 · OH-1004

Endoplasmic reticulum0.018

Rank 4 · LXL04_015358 · OH-1004

Plastid0.015

Rank 5 · LXL04_015358 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00249.38Myb_DNA-binding102-149 aa

PF13921.13Myb_DNA-bind_6105-163 aa

PF00249.38Myb_DNA-binding155-198 aa

PF13921.13Myb_DNA-bind_6159-201 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_015358	`PF00249.38`	Myb_DNA-binding	102	149	5.5e-36	123.2
LXL04_015358	`PF13921.13`	Myb_DNA-bind_6	105	163	3.2e-21	76.0
LXL04_015358	`PF00249.38`	Myb_DNA-binding	155	198	5.5e-36	123.2
LXL04_015358	`PF13921.13`	Myb_DNA-bind_6	159	201	3.2e-21	76.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FGY3`	Arabidopsis thaliana	Transcription factor MYB78	58.246%	Swiss-Prot	strong database homology
`Q9LDE1`	Arabidopsis thaliana	Transcription factor MYB108	89.552%	Swiss-Prot	weak database homology
`Q9C9G7`	Arabidopsis thaliana	Transcription factor MYB62	69.231%	Swiss-Prot	weak database homology
`Q10MB4`	Oryza sativa subsp. japonica	Transcription factor MYB2	86.525%	Swiss-Prot	weak database homology
`Q2QZJ8`	Oryza sativa subsp. japonica	Transcription factor JAMYB	70.455%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card