RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

TkA02G336420
Reference: TK1151 Chr: Chr02 Coordinates: 85347540-85353397 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

3144 bp · TkA02G336420|TK1151|cDNA

CACTTTTAACACCCATTATTGCTTCATCGCTCTCGACACTTTTTTTTCTACAAGACATTGAATTTTCGCAGACAATCTGGATTTTTTCTTCATCTGCCGTTATTGGTTGCTGAGCTTTGATTTTGGCCATCGGAGATTGCAGCGATCAAGTATTATAGAGCAATTTTACTCAAAGACTGAAACCCGCCTACTTTCTACTAGCAACGAATCATCGTGATAGCTTCTCCGTTATTTCGAATATTTTGTGGTTGTTTTAGACC...

CDS

Download CDS FASTA

2538 bp · TkA02G336420|TK1151|CDS

ATGGAGCCTGCCGTACCATCGCAACTTGTCGGTTCAGAGATTCATGGGTTTAAAACCATGCAAGATTTAGATGTACCCACCATGTTCGAGGAAGCCAAGACAAGATGGCTTCGGCCAAATGAGATCCATGCAATTCTTTGTAACCACAAGCATTTCAACATTCACGTGAAGCCTGTGAATTTGCCAAAAAGTGGCACCATTGTCCTATTTGACCGAAAGATGCTCAGAAACTTCCGAAAGGACGGGTACAACTGGAAAAA...

Protein

Download Protein FASTA

845 aa · TkA02G336420|TK1151|PROTEIN

MEPAVPSQLVGSEIHGFKTMQDLDVPTMFEEAKTRWLRPNEIHAILCNHKHFNIHVKPVNLPKSGTIVLFDRKMLRNFRKDGYNWKKKKDGKTVKEAHEHLKVGNDERIHVYYAHGEDQSTFVRRCYWLLDKKLENIVLVHYRDTQELQGSPTIESNSSSDPPASWNLSGENDGVDQVYKTEPIETIINHKMRLHEINTLEWEELVVPDDSNKSITPQGGNISYFDQGDQYGLNGIVDTMDPGFMNSTTDMLDTIGKDGL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDTkA02G336420
TK1151 IDTkA02G336420
OH-1004 IDLXL04_015411
Relationship / confidenceRbh High Identity Coverage Synteny / Strict
Protein identity (%)98.500
Protein coverage (%)TK1151 100.000 / OH-1004 100.000
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionTK1151 / GWHBCHF00000000
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDTkA02G336420
LocationChr02:85347540-85353397 (+)
DescriptionSimilar to CAMTA5: Calmodulin-binding transcription activator 5
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
At4g16150 Transcription activator.
Arabidopsis CAMTA family proteins enhance V-PPase expression in pollen.2003 · DOI: 10.1093/pcp/pcg137
Different Cold-Signaling Pathways Function in the Responses to Rapid and Gradual Decreases in Temperature.2017 · DOI: 10.1105/tpc.16.00669
At3g16940 Transcription activator that binds calmodulin in a calcium-dependent manner in vitro.
A novel family of calmodulin-binding transcription activators in multicellular organisms.2002 · DOI: 10.1074/jbc.m200268200
At2g22300 Transcription activator that binds to the DNA consensus sequence 5'-[ACG]CGCG[GTC]-3'.
Calmodulin-binding transcription activator (CAMTA) 3 mediates biotic defense responses in Arabidopsis.2008 · DOI: 10.1016/j.febslet.2008.02.037
Ca(2+)/calmodulin regulates salicylic-acid-mediated plant immunity.2009 · DOI: 10.1038/nature07612
Roles for Arabidopsis CAMTA transcription factors in cold-regulated gene expression and freezing tolerance.2009 · DOI: 10.1105/tpc.108.063958
Brush and spray: a high-throughput systemic acquired resistance assay suitable for large-scale genetic screening.2011 · DOI: 10.1104/pp.111.182089
The calmodulin-binding transcription factor SIGNAL RESPONSIVE1 is a novel regulator of glucosinolate metabolism and herbivory tolerance in Arabidopsis.2012 · DOI: 10.1093/pcp/pcs143
Roles of CAMTA transcription factors and salicylic acid in configuring the low-temperature transcriptome and freezing tolerance of Arabidopsis.2013 · DOI: 10.1111/tpj.12205
A key general stress response motif is regulated non-uniformly by CAMTA transcription factors.2014 · DOI: 10.1111/tpj.12620
Distinct roles for mitogen-activated protein kinase signaling and CALMODULIN-BINDING TRANSCRIPTIONAL ACTIVATOR3 in regulating the peak time and amplitude of the plant general stress response.2014 · DOI: 10.1104/pp.114.245944
Different Cold-Signaling Pathways Function in the Responses to Rapid and Gradual Decreases in Temperature.2017 · DOI: 10.1105/tpc.16.00669
Matching NLR Immune Receptors to Autoimmunity in camta3 Mutants Using Antimorphic NLR Alleles.2017 · DOI: 10.1016/j.chom.2017.03.005
At1g67310 Transcription activator that binds to the DNA consensus sequence 5'-[ACG]CGCG[GTC]-3' (By similarity). No verified direct reference in this release

Rice

Reference gene IDPossible functionPapers / DOI
Os07g0490200 Transcription activator that binds calmodulin in a calcium-dependent manner in vitro. No verified direct reference in this release
Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_015411 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)
GO:0006351 DNA-templated transcription Biological Process
GO:0006355 regulation of DNA-templated transcription Biological Process
GO:0006357 regulation of transcription by RNA polymerase II Biological Process
GO:0009409 response to cold Biological Process
GO:0009651 response to salt stress Biological Process
GO:0010150 leaf senescence Biological Process
GO:0042742 defense response to bacterium Biological Process
GO:0045893 positive regulation of DNA-templated transcription Biological Process
GO:0050832 defense response to fungus Biological Process
GO:0070417 cellular response to cold Biological Process
GO:0106167 extracellular ATP signaling Biological Process
GO:1900367 positive regulation of defense response to insect Biological Process
KEGG gene cross-reference
ath:AT2G22300
ath:AT3G16940
ath:AT4G15200
ath:AT4G15950
ath:AT4G16150
ath:AT4G17100
ath:AT4G35335
dosa:Os07g0490200
osa:4343265
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.489
Rank 1 · TkA02G336420 · TK1151
Nucleus0.444
Rank 2 · TkA02G336420 · TK1151
Cell membrane0.131
Rank 3 · TkA02G336420 · TK1151
Endoplasmic reticulum0.046
Rank 4 · TkA02G336420 · TK1151
Golgi apparatus0.043
Rank 5 · TkA02G336420 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03859CG-131-144 aa
PF23090MBTPS1_4th50-135 aa
PF23090MBTPS1_4th222-271 aa
PF01833TIG296-381 aa
PF13606Ank_3471-484 aa
PF12796Ank_2478-560 aa
PF13637Ank_4478-507 aa
PF12796Ank_2521-593 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
TkA02G336420PF03859CG-1311445.4e-46155.8
TkA02G336420PF23090MBTPS1_4th501350.05813.5
TkA02G336420PF23090MBTPS1_4th2222710.05813.5
TkA02G336420PF01833TIG2963815.7e-0730.2
TkA02G336420PF13606Ank_34714840.004718.0
TkA02G336420PF12796Ank_24785605.1e-1350.1
TkA02G336420PF13637Ank_44785078.2e-0626.7
TkA02G336420PF12796Ank_25215935.1e-1350.1
TkA02G336420PF13637Ank_45225528.2e-0626.7
TkA02G336420PF13857Ank_55265620.2712.4
TkA02G336420PF00023Ank5325621.8e-0834.9
TkA02G336420PF13606Ank_35325590.004718.0
TkA02G336420PF13637Ank_45365908.2e-0626.7
TkA02G336420PF00023Ank5715911.8e-0834.9
TkA02G336420PF13606Ank_35715920.004718.0
TkA02G336420PF27003DUF83246197135.28.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
O23463Arabidopsis thalianasp|O23463|CMTA5_ARATH Calmodulin-binding transcription activator 553.700%Swiss-ProtHigh
Q9LSP8Arabidopsis thalianasp|Q9LSP8|CMTA6_ARATH Calmodulin-binding transcription activator 652.500%Swiss-ProtHigh
Q8GSA7Arabidopsis thalianasp|Q8GSA7|CMTA3_ARATH Calmodulin-binding transcription activator 330.600%Swiss-ProtMedium
Q9FYG2Arabidopsis thalianasp|Q9FYG2|CMTA4_ARATH Calmodulin-binding transcription activator 428.100%Swiss-ProtLow
Q7XHR2Oryza sativa subsp. japonicasp|Q7XHR2|CBT_ORYSJ Calmodulin-binding transcription activator CBT43.700%Swiss-ProtMedium

JBrowse

View in Genome Browser