TkA02G330160 | RubberDandelionOmics

Gene overview

TkA02G330160

Reference: TK1151 Chr: Chr02 Coordinates: 83750717-83756139 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2247 bp · TkA02G330160|TK1151|cDNA

CACTTTTTTGTCCGAATTTTAAAAACCTGTGGTCAACAAAAGTTAGACGTAACATGTAAAGAAGAAAAAAAATTAAAAGAATAACACCTCGTAAAGGGAATTTTGATTTTTAATCTAAGAAAGTTCCCTCCTTTTTCTTTATTTTGTGATTTCAAGAAAAGTAAACTTTTGCCAGTCCACAGTCTCCATCTTGCAGCATCGTAACAAACCTCGTCGCCATAGCAACAAATCAGCGTCATTCTTCTCCATTAAAACCCCAT...

CDS

Download CDS FASTA

1359 bp · TkA02G330160|TK1151|CDS

ATGAAAATCGTTCTCGGTTTTTTGTTTGTTTTAGCTTTCGATTTCGAAATTACCTCAACTGATGCCAGACCCGAAGGTTCGTTTATTGTTTCCGCGATTTCTGTTCCTGAATCCTCACCTGCTGGACCTCCAATTCCTTCAATCCCGTCATCAATGGCCGACTTCACTTCAGGAGCTGAAATCGATATCACGAATCACAAACACGATTCAAGTCGAAAGCTTCTTATTGGGCTCATCGCAGCTTCGTCTGTAATGGGAAT...

Protein

Download Protein FASTA

452 aa · TkA02G330160|TK1151|PROTEIN

MKIVLGFLFVLAFDFEITSTDARPEGSFIVSAISVPESSPAGPPIPSIPSSMADFTSGAEIDITNHKHDSSRKLLIGLIAASSVMGIVVISIICLWTCHRKKTYKSGKIGTKKLDSLRGLPLSSFVTRTNGAFKTKNEKGSATVMDYSLLQSATNNFSESEILGVGGFGCVYKARLDDNLHVAVKRLDGVSQDAIKEFQTEVDLLSKIHHPNIITLLGYCVHDETKLLVYELMHNGSLETQLHGPSSGSNLTWHCRMKIA...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G330160`
TK1151 ID	TkA02G330160
OH-1004 ID	LXL04_015455
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G330160

Location Chr02:83750717-83756139 (+)

Description Similar to At1g80640: Probable receptor-like protein kinase At1g80640

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g80640`	Probable receptor-like protein kinase At1g80640.	No verified direct reference in this release
`At2g20300`	Required during the differentiation of the protoderm into shoots epidermis and cuticle.	Novel receptor-like kinase ALE2 controls shoot development by specifying epidermis in Arabidopsis.2007 · DOI: 10.1242/dev.003533
`At5g02800`	Serine/threonine-protein kinase involved in the positive regulation of brassinosteroid (BR) signaling and plant growth.	No verified direct reference in this release
`At1g20650`	May be involved in plant defense signaling.	No verified direct reference in this release
`At2g28590`	May be involved in plant defense signaling.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_015455 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006468 protein phosphorylation Biological Process

GO:0006952 defense response Biological Process

GO:0007165 signal transduction Biological Process

GO:0009742 brassinosteroid mediated signaling pathway Biological Process

GO:0010068 protoderm histogenesis Biological Process

GO:0010183 pollen tube guidance Biological Process

GO:0030154 cell differentiation Biological Process

GO:0046777 protein autophosphorylation Biological Process

GO:0090558 plant epidermis development Biological Process

GO:1900459 positive regulation of brassinosteroid mediated signaling pathway Biological Process

GO:1905393 plant organ formation Biological Process

GO:0005576 extracellular region Cellular Component

KEGG gene cross-reference

ath:AT1G20650

ath:AT1G80640

ath:AT2G20300

ath:AT3G20530

ath:AT5G02800

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.840

Rank 1 · TkA02G330160 · TK1151

Endoplasmic reticulum0.092

Rank 2 · TkA02G330160 · TK1151

Cytoplasm0.091

Rank 3 · TkA02G330160 · TK1151

Nucleus0.063

Rank 4 · TkA02G330160 · TK1151

Lysosome / Vacuole0.028

Rank 5 · TkA02G330160 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03109ABC1145-187 aa

PF00069Pkinase158-375 aa

PF07714PK_Tyr_Ser-Thr160-380 aa

PF14531Kinase-like249-329 aa

PF17667Pkinase_fungal265-340 aa

PF03109ABC1269-306 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G330160	`PF03109`	ABC1	145	187	0.00016	21.7
TkA02G330160	`PF00069`	Pkinase	158	375	5.1e-47	161.2
TkA02G330160	`PF07714`	PK_Tyr_Ser-Thr	160	380	7.7e-48	163.8
TkA02G330160	`PF14531`	Kinase-like	249	329	0.14	12.2
TkA02G330160	`PF17667`	Pkinase_fungal	265	340	0.31	10.4
TkA02G330160	`PF03109`	ABC1	269	306	0.00016	21.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q0V7T5`	Arabidopsis thaliana	sp\|Q0V7T5\|Y1864_ARATH Probable receptor-like protein kinase At1g80640	52.900%	Swiss-Prot	High
`Q8RWW0`	Arabidopsis thaliana	sp\|Q8RWW0\|ALE2_ARATH Receptor-like serine/threonine-protein kinase ALE2	42.300%	Swiss-Prot	Medium
`Q0WRY5`	Arabidopsis thaliana	sp\|Q0WRY5\|PBL7_ARATH Probable serine/threonine-protein kinase PBL7	43.800%	Swiss-Prot	Medium
`Q9LDZ5`	Arabidopsis thaliana	sp\|Q9LDZ5\|PBL21_ARATH Probable serine/threonine-protein kinase PBL21	45.500%	Swiss-Prot	Medium
`Q9SIB6`	Arabidopsis thaliana	sp\|Q9SIB6\|PBL6_ARATH Probable serine/threonine-protein kinase PBL6	47.600%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card