LXL04_015455 | RubberDandelionOmics

Gene overview

LXL04_015455

Reference: OH-1004 Chr: Chr03 Coordinates: 72549597-72554090 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1359 bp · LXL04_015455|LXL04_015455|OH1004|cDNA

ATGAAAATCGTTCTCggttttttgtttgttttagctttCGATTTCGAAATTACCTCAACTGATGCCAGACCCGAAGGTTCGTTTATTGTTTCCGCGATTTCTGTTCCTGAATCCTCACCTGCTGGACCTCCAATTCCTTCAATCCCGTCATCAATGGCCGACTTCACTTCAGGAGCTGAAATCGATATCACGAATCACAAACACGATTCAAGTCGAAAGCTTCTTATTGGGCTCATCGCAGCTTCGTCTGTAATGGGAAT...

CDS

Download CDS FASTA

1359 bp · LXL04_015455|LXL04_015455|OH1004|CDS

ATGAAAATCGTTCTCGGTTTTTTGTTTGTTTTAGCTTTCGATTTCGAAATTACCTCAACTGATGCCAGACCCGAAGGTTCGTTTATTGTTTCCGCGATTTCTGTTCCTGAATCCTCACCTGCTGGACCTCCAATTCCTTCAATCCCGTCATCAATGGCCGACTTCACTTCAGGAGCTGAAATCGATATCACGAATCACAAACACGATTCAAGTCGAAAGCTTCTTATTGGGCTCATCGCAGCTTCGTCTGTAATGGGAAT...

Protein

Download Protein FASTA

452 aa · LXL04_015455|LXL04_015455|OH1004|PROTEIN

MKIVLGFLFVLAFDFEITSTDARPEGSFIVSAISVPESSPAGPPIPSIPSSMADFTSGAEIDITNHKHDSSRKLLIGLIAASSVMGIVVISIICLWTCHRKKTYKSGKIGTKKLDSLRGLPLSSFVTRTNGAFKTKNEKGSATVMDYSLLQSATNNFSESEILGVGGFGCVYKARLDDNLHVAVKRLDGVSQDAIKEFQTEVDLLSKIHHPNIITLLGYCVHDETKLLVYELMHNGSLETQLHGPSSGSNLTWHCRMKIA...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_015455`
TK1151 ID	TkA02G330160
OH-1004 ID	LXL04_015455
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_015455

Location Chr03:72549597-72554090 (-)

Description Similar to At1g80640: Probable receptor-like protein kinase At1g80640

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g80640`	Probable receptor-like protein kinase At1g80640.	No verified direct reference in this release
`At2g20300`	Required during the differentiation of the protoderm into shoots epidermis and cuticle.	Novel receptor-like kinase ALE2 controls shoot development by specifying epidermis in Arabidopsis.2007 · DOI: 10.1242/dev.003533
`At1g20650`	May be involved in plant defense signaling.	No verified direct reference in this release
`At5g02800`	Serine/threonine-protein kinase involved in the positive regulation of brassinosteroid (BR) signaling and plant growth.	No verified direct reference in this release
`At3g20530`	May be involved in plant defense signaling.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_015455 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006468 protein phosphorylation Biological Process

GO:0006952 defense response Biological Process

GO:0007165 signal transduction Biological Process

GO:0009742 brassinosteroid mediated signaling pathway Biological Process

GO:0010068 protoderm histogenesis Biological Process

GO:0010183 pollen tube guidance Biological Process

GO:0030154 cell differentiation Biological Process

GO:0046777 protein autophosphorylation Biological Process

GO:0090558 plant epidermis development Biological Process

GO:1900459 positive regulation of brassinosteroid mediated signaling pathway Biological Process

GO:1905393 plant organ formation Biological Process

GO:0005576 extracellular region Cellular Component

KEGG gene cross-reference

ath:AT1G20650

ath:AT1G80640

ath:AT2G20300

ath:AT3G20530

ath:AT5G02800

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.840

Rank 1 · LXL04_015455 · OH-1004

Endoplasmic reticulum0.092

Rank 2 · LXL04_015455 · OH-1004

Cytoplasm0.091

Rank 3 · LXL04_015455 · OH-1004

Nucleus0.063

Rank 4 · LXL04_015455 · OH-1004

Lysosome / Vacuole0.028

Rank 5 · LXL04_015455 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00069.32Pkinase158-375 aa

PF07714.24PK_Tyr_Ser-Thr160-380 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_015455	`PF00069.32`	Pkinase	158	375	5.1e-47	161.2
LXL04_015455	`PF07714.24`	PK_Tyr_Ser-Thr	160	380	7.7e-48	163.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q0V7T5`	Arabidopsis thaliana	Probable receptor-like protein kinase At1g80640	53.258%	Swiss-Prot	strong database homology
`Q8RWW0`	Arabidopsis thaliana	Receptor-like serine/threonine-protein kinase ALE2	47.059%	Swiss-Prot	moderate database homology
`Q9LDZ5`	Arabidopsis thaliana	Probable serine/threonine-protein kinase PBL21	45.515%	Swiss-Prot	moderate database homology
`Q0WRY5`	Arabidopsis thaliana	Probable serine/threonine-protein kinase PBL7	46.897%	Swiss-Prot	moderate database homology
`F4JEQ2`	Arabidopsis thaliana	Probable serine/threonine-protein kinase PBL23	46.575%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card