RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

TkA02G319860
Reference: TK1151 Chr: Chr02 Coordinates: 81252745-81254998 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

1992 bp · TkA02G319860|TK1151|cDNA

ATGCTAATCCTATTGCTTACCGTCCTTGTTCTCGCGAACCCTGGATCTTGTGATGTCAGTTTCTCGTTTGCTTCTTTTGATTCAAATAGTTGCGATCAAGATGGTGATTTAATTTGTATGGGATCGGTAAAATCAAGAAACGGGAGTTTGATTATCACTCAAGTTGAAGACGATGAACAAGTGAACATAAACAAATCATCCCCGAATTTAATCGGAAGGGTTTTGTACAAAACTCCGGTCATTGCATGGCCTGCAACCTT...

CDS

Download CDS FASTA

1992 bp · TkA02G319860|TK1151|CDS

ATGCTAATCCTATTGCTTACCGTCCTTGTTCTCGCGAACCCTGGATCTTGTGATGTCAGTTTCTCGTTTGCTTCTTTTGATTCAAATAGTTGCGATCAAGATGGTGATTTAATTTGTATGGGATCGGTAAAATCAAGAAACGGGAGTTTGATTATCACTCAAGTTGAAGACGATGAACAAGTGAACATAAACAAATCATCCCCGAATTTAATCGGAAGGGTTTTGTACAAAACTCCGGTCATTGCATGGCCTGCAACCTT...

Protein

Download Protein FASTA

663 aa · TkA02G319860|TK1151|PROTEIN

MLILLLTVLVLANPGSCDVSFSFASFDSNSCDQDGDLICMGSVKSRNGSLIITQVEDDEQVNINKSSPNLIGRVLYKTPVIAWPATFSTTFTIRIVVDPYSALSGDGMAFIIAQDNQPSPQQSYGSYIGILAPSTQSGTLRQLAVELDTYKNEYVSDPDGNHIAIDTISIQDPVVVKSLEKTGIDLKSGREITVQITYDGWEKKLKILVAYTGEPLFEIINQRIIMKKTVPRQVYVGFTGATGGAQESHRVINWNFSSTE...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDTkA02G319860
TK1151 IDTkA02G319860
OH-1004 IDLXL04_015530
Relationship / confidenceMulti Source To Oh1004 / Complex relationship
Protein identity (%)99.800
Protein coverage (%)TK1151 100.000 / OH-1004 100.000
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionTK1151 / GWHBCHF00000000
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDTkA02G319860
LocationChr02:81252745-81254998 (-)
DescriptionSimilar to LECRKS7: Probable L-type lectin-domain containing receptor kinase S.7
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
At5g06740 Probable L-type lectin-domain containing receptor kinase S.5. No verified direct reference in this release
At5g55830 Involved in resistance response to the pathogenic oomycetes Phytophthora infestans and Phytophthora capsici. No verified direct reference in this release
At5g03140 Involved in resistance response to the pathogenic oomycetes Phytophthora infestans and Phytophthora capsici. No verified direct reference in this release
At3g53380 L-type lectin-domain containing receptor kinase VIII.1. No verified direct reference in this release
At3g55550 Involved in resistance response to the pathogenic oomycetes Phytophthora infestans and Phytophthora capsici and to the pathogenic bacteria Pseudomonas syringae. No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_015530 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)
GO:0002229 defense response to oomycetes Biological Process
GO:0009626 plant-type hypersensitive response Biological Process
GO:0042742 defense response to bacterium Biological Process
GO:0005576 extracellular region Cellular Component
GO:0005739 mitochondrion Cellular Component
GO:0005886 plasma membrane Cellular Component
GO:0009507 chloroplast Cellular Component
GO:0004674 protein serine/threonine kinase activity Molecular Function
GO:0004675 transmembrane receptor protein serine/threonine kinase activity Molecular Function
GO:0005524 ATP binding Molecular Function
GO:0030246 carbohydrate binding Molecular Function
GO:0106310 protein serine kinase activity Molecular Function
KEGG gene cross-reference
ath:AT3G55550
ath:AT5G03140
ath:AT5G06740
ath:AT5G10530
ath:AT5G55830
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.832
Rank 1 · TkA02G319860 · TK1151
Endoplasmic reticulum0.087
Rank 2 · TkA02G319860 · TK1151
Cytoplasm0.086
Rank 3 · TkA02G319860 · TK1151
Nucleus0.045
Rank 4 · TkA02G319860 · TK1151
Lysosome / Vacuole0.040
Rank 5 · TkA02G319860 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00139Lectin_legB19-264 aa
PF03388Lectin_leg-like55-255 aa
PF18483Lectin_L-type_dom57-251 aa
PF15102TMEM154274-323 aa
PF09682Phage_holin_6_1281-327 aa
PF28747SECTM1_C288-315 aa
PF00069Pkinase344-604 aa
PF07714PK_Tyr_Ser-Thr346-604 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
TkA02G319860PF00139Lectin_legB192644.7e-45154.8
TkA02G319860PF03388Lectin_leg-like552550.0005620.1
TkA02G319860PF18483Lectin_L-type_dom572511.2e-1455.4
TkA02G319860PF15102TMEM1542743230.08213.5
TkA02G319860PF09682Phage_holin_6_12813270.2212.7
TkA02G319860PF28747SECTM1_C2883150.3211.5
TkA02G319860PF00069Pkinase3446043e-44152.1
TkA02G319860PF07714PK_Tyr_Ser-Thr3466043.5e-39135.4
TkA02G319860PF17667Pkinase_fungal4295310.005816.1
TkA02G319860PF07387Seadorna_VP74415380.1312.0
TkA02G319860PF14531Kinase-like4605520.05813.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
Q9FG33Arabidopsis thalianasp|Q9FG33|LRKS5_ARATH Probable L-type lectin-domain containing receptor kinase S.539.500%Swiss-ProtMedium
Q9FHG4Arabidopsis thalianasp|Q9FHG4|LRKS7_ARATH Probable L-type lectin-domain containing receptor kinase S.735.600%Swiss-ProtMedium
Q9LYX1Arabidopsis thalianasp|Q9LYX1|LRK82_ARATH L-type lectin-domain containing receptor kinase VIII.236.800%Swiss-ProtMedium
Q9LFH9Arabidopsis thalianasp|Q9LFH9|LRK81_ARATH L-type lectin-domain containing receptor kinase VIII.136.400%Swiss-ProtMedium
Q9M2S4Arabidopsis thalianasp|Q9M2S4|LRKS4_ARATH L-type lectin-domain containing receptor kinase S.435.000%Swiss-ProtMedium

JBrowse

View in Genome Browser