TkA02G305740 | RubberDandelionOmics

Gene overview

TkA02G305740

Reference: TK1151 Chr: Chr02 Coordinates: 77835926-77838459 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

348 bp · TkA02G305740|TK1151|cDNA

ATGATCCTTAGGTTTAACCCCGTTAAGCAAATGTCGTTACTGCTATCACCTGCCCTTCAAGTCAAGTTAGGGTTTATACGTTCTGTATTGGATGAACACTCTCACTGTTTAAGATGGCATGCAGTGGGGTCATGGACATGGGATGCTCATGATGAGACATGTGGGATATGTCGGATGGCGTTTGATGGTTGTTGTCCTGATTGTAAACTACCTGGTGATGATTGCCCACTAATTTGGGGTGCTTGCAATCATGCTTTCCA...

CDS

Download CDS FASTA

348 bp · TkA02G305740|TK1151|CDS

ATGATCCTTAGGTTTAACCCCGTTAAGCAAATGTCGTTACTGCTATCACCTGCCCTTCAAGTCAAGTTAGGGTTTATACGTTCTGTATTGGATGAACACTCTCACTGTTTAAGATGGCATGCAGTGGGGTCATGGACATGGGATGCTCATGATGAGACATGTGGGATATGTCGGATGGCGTTTGATGGTTGTTGTCCTGATTGTAAACTACCTGGTGATGATTGCCCACTAATTTGGGGTGCTTGCAATCATGCTTTCCA...

Protein

Download Protein FASTA

115 aa · TkA02G305740|TK1151|PROTEIN

MILRFNPVKQMSLLLSPALQVKLGFIRSVLDEHSHCLRWHAVGSWTWDAHDETCGICRMAFDGCCPDCKLPGDDCPLIWGACNHAFHLHCILKWVNSQTPQAHCPMCRREWQFKE

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G305740`
TK1151 ID	TkA02G305740
OH-1004 ID	LXL04_015659
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	100.000
Protein coverage (%)	TK1151 67.826 / OH-1004 72.897 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G305740

Location Chr02:77835926-77838459 (-)

Description Similar to APC11: Anaphase-promoting complex subunit 11

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g05870`	Component of the anaphase promoting complex/cyclosome (APC/C), a cell cycle-regulated E3 ubiquitin-protein ligase complex that controls progression through mitosis and the G1 phase of the cell cycle.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_015659 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0000278 mitotic cell cycle Biological Process

GO:0006511 ubiquitin-dependent protein catabolic process Biological Process

GO:0007346 regulation of mitotic cell cycle Biological Process

GO:0016567 protein ubiquitination Biological Process

GO:0031145 anaphase-promoting complex-dependent catabolic process Biological Process

GO:0031146 SCF-dependent proteasomal ubiquitin-dependent protein catabolic process Biological Process

GO:0045842 positive regulation of mitotic metaphase/anaphase transition Biological Process

GO:0051301 cell division Biological Process

GO:0051445 regulation of meiotic cell cycle Biological Process

GO:0070936 protein K48-linked ubiquitination Biological Process

GO:0070979 protein K11-linked ubiquitination Biological Process

GO:0141198 protein branched polyubiquitination Biological Process

KEGG gene cross-reference

ath:AT3G05870

bta:616275

hsa:51529

mmu:66156

pon:100173127

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.451

Rank 1 · TkA02G305740 · TK1151

Nucleus0.404

Rank 2 · TkA02G305740 · TK1151

Endoplasmic reticulum0.099

Rank 3 · TkA02G305740 · TK1151

Golgi apparatus0.095

Rank 4 · TkA02G305740 · TK1151

Mitochondrion0.095

Rank 5 · TkA02G305740 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF13923zf-C3HC4_229-36 aa

PF12861zf-ANAPC1132-45 aa

PF15227zf-C3HC4_432-57 aa

PF12678zf-rbx133-38 aa

PF23413zf_RING_Vps8_fungal33-38 aa

PF13639zf-RING_234-58 aa

PF13445zf-RING_UBOX34-40 aa

PF14634zf-RING_550-58 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G305740	`PF13923`	zf-C3HC4_2	29	36	0.035	14.6
TkA02G305740	`PF12861`	zf-ANAPC11	32	45	2.3e-34	117.9
TkA02G305740	`PF15227`	zf-C3HC4_4	32	57	0.089	13.6
TkA02G305740	`PF12678`	zf-rbx1	33	38	1.4e-21	77.2
TkA02G305740	`PF23413`	zf_RING_Vps8_fungal	33	38	0.034	14.1
TkA02G305740	`PF13639`	zf-RING_2	34	58	0.0039	18.1
TkA02G305740	`PF13445`	zf-RING_UBOX	34	40	0.72	10.6
TkA02G305740	`PF14634`	zf-RING_5	50	58	4.6	8.0
TkA02G305740	`PF12861`	zf-ANAPC11	51	115	2.3e-34	117.9
TkA02G305740	`PF12678`	zf-rbx1	52	108	1.4e-21	77.2
TkA02G305740	`PF13639`	zf-RING_2	53	108	0.0039	18.1
TkA02G305740	`PF23413`	zf_RING_Vps8_fungal	53	58	0.034	14.1
TkA02G305740	`PF13923`	zf-C3HC4_2	53	68	0.035	14.6
TkA02G305740	`PF25491`	CCHC_BCL-11A	53	61	0.11	13.3
TkA02G305740	`PF29452`	FAR1_N	53	58	3.2	8.6
TkA02G305740	`PF13445`	zf-RING_UBOX	54	105	0.72	10.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9M9L0`	Arabidopsis thaliana	sp\|Q9M9L0\|APC11_ARATH Anaphase-promoting complex subunit 11	94.900%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card