TkA02G300010 | RubberDandelionOmics

Gene overview

TkA02G300010

Reference: TK1151 Chr: Chr02 Coordinates: 76454251-76455377 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

423 bp · TkA02G300010|TK1151|cDNA

CTTCACCTTTTCGGGGAGGTCATTCGAACTTGTGTACACGAGAGGAAGCCAAGCAACTGCGACCCTCGGAGTTCTTCGATGGATCACACAGTAGGTCCCAGTGAGGAGGTTCCGGTGGCCGTCGACGATAATGCCGGCACTGTAACCAATAGCCGTTTTCATATTGCGACTTGTTCATCTTCTTCTTCCTGCAACCAACAGGGCACTAAAGGGTGGGGCACTATATTGCTTGCTTACAAGTCATTAGGAGTTGTCTTTGG...

CDS

Download CDS FASTA

345 bp · TkA02G300010|TK1151|CDS

ATGGATCACACAGTAGGTCCCAGTGAGGAGGTTCCGGTGGCCGTCGACGATAATGCCGGCACTGTAACCAATAGCCGTTTTCATATTGCGACTTGTTCATCTTCTTCTTCCTGCAACCAACAGGGCACTAAAGGGTGGGGCACTATATTGCTTGCTTACAAGTCATTAGGAGTTGTCTTTGGAGGGCTTGTGACTTCTCCACTTTATGTGTACCCTTCAATGGCATTAAAGTCTCCAACAAAAGAAGACTACTTGGGAAT...

Protein

Download Protein FASTA

115 aa · TkA02G300010|TK1151|PROTEIN

MDHTVGPSEEVPVAVDDNAGTVTNSRFHIATCSSSSSCNQQGTKGWGTILLAYKSLGVVFGGLVTSPLYVYPSMALKSPTKEDYLGIYSIMFWTLTLIGVVKYACIALKADDQGE

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G300010`
TK1151 ID	TkA02G300010
OH-1004 ID	LXL04_015698
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 15.625 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G300010

Location Chr02:76454251-76455377 (+)

Description Similar to HAK17: Probable potassium transporter 17

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g14880`	Probable potassium transporter.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os09g0448200`	High-affinity potassium transporter.	No verified direct reference in this release
`Os08g0466200`	High-affinity potassium transporter.	No verified direct reference in this release
`Os01g0932500`	High-affinity potassium transporter.	No verified direct reference in this release
`Os08g0510300`	High-affinity potassium transporter.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_015698 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006813 potassium ion transport Biological Process

GO:0005886 plasma membrane Cellular Component

GO:0016020 membrane Cellular Component

GO:0015079 potassium ion transmembrane transporter activity Molecular Function

KEGG gene cross-reference

ath:AT2G30070

dosa:Os01g0932500

dosa:Os08g0466200

dosa:Os08g0510300

dosa:Os09g0448200

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.390

Rank 1 · TkA02G300010 · TK1151

Lysosome / Vacuole0.355

Rank 2 · TkA02G300010 · TK1151

Endoplasmic reticulum0.184

Rank 3 · TkA02G300010 · TK1151

Cytoplasm0.127

Rank 4 · TkA02G300010 · TK1151

Golgi apparatus0.105

Rank 5 · TkA02G300010 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03616Glt_symporter19-69 aa

PF02705K_trans50-115 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G300010	`PF03616`	Glt_symporter	19	69	0.1	12.0
TkA02G300010	`PF02705`	K_trans	50	115	1.1e-17	64.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9M7J9`	Arabidopsis thaliana	sp\|Q9M7J9\|POT8_ARATH Potassium transporter 8	55.400%	Swiss-Prot	Medium
`Q67UC7`	Oryza sativa subsp. japonica	sp\|Q67UC7\|HAK17_ORYSJ Probable potassium transporter 17	82.900%	Swiss-Prot	Medium
`Q6YSA9`	Oryza sativa subsp. japonica	sp\|Q6YSA9\|HAK4_ORYSJ Probable potassium transporter 4	85.100%	Swiss-Prot	Medium
`Q5JMH0`	Oryza sativa subsp. japonica	sp\|Q5JMH0\|HAK6_ORYSJ Potassium transporter 6	58.600%	Swiss-Prot	Medium
`Q84YJ9`	Oryza sativa subsp. japonica	sp\|Q84YJ9\|HAK26_ORYSJ Potassium transporter 26	57.600%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card