LXL04_015698 | RubberDandelionOmics

Gene overview

LXL04_015698

Reference: OH-1004 Chr: Chr03 Coordinates: 80593270-80597323 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2211 bp · LXL04_015698|LXL04_015698|OH1004|cDNA

ATGGATCACACAGTAGGTCCCAGTGAGGAGGTTCCGGTGGCCGTCGACGATAATGCCGGCACTGTAACCAATAGCCGTTTTCATATTGCGActtgttcatcttcttcttcctgcAACCAACAGGGCACTAAAGGGTGGGGCACTATATTGCTTGCTTACAAGTCATTAGGAGTTGTCTTTGGAGGGCTTGTGACTTCTCCACTTTATGTGTACCCTTCAATGGCATTAAAGTCTCCAACAAAAGAAGACTACTTGGGAAT...

CDS

Download CDS FASTA

2211 bp · LXL04_015698|LXL04_015698|OH1004|CDS

ATGGATCACACAGTAGGTCCCAGTGAGGAGGTTCCGGTGGCCGTCGACGATAATGCCGGCACTGTAACCAATAGCCGTTTTCATATTGCGACTTGTTCATCTTCTTCTTCCTGCAACCAACAGGGCACTAAAGGGTGGGGCACTATATTGCTTGCTTACAAGTCATTAGGAGTTGTCTTTGGAGGGCTTGTGACTTCTCCACTTTATGTGTACCCTTCAATGGCATTAAAGTCTCCAACAAAAGAAGACTACTTGGGAAT...

Protein

Download Protein FASTA

736 aa · LXL04_015698|LXL04_015698|OH1004|PROTEIN

MDHTVGPSEEVPVAVDDNAGTVTNSRFHIATCSSSSSCNQQGTKGWGTILLAYKSLGVVFGGLVTSPLYVYPSMALKSPTKEDYLGIYSIMFWTLTLIGVVKYACIALKADDQGEGGTFALYSLLCRHMNIGSITSTSVSSQSSHSYNNLHQGFEKPSRLGMFIERSLIARRVLFFIAILGMCMLIGDGILTPAISVLSAMDGIRGPYPEFSNSLVEALSALVLVILFLVQKYGTARVSFLFSPIMGAWTLTTPLIGIYN...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_015698`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_015698

Location Chr03:80593270-80597323 (-)

Description Similar to HAK17: Probable potassium transporter 17

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g30070`	High-affinity potassium transporter that could play a major role in the uptake of potassium from the rhizosphere.	AtKUP1: an Arabidopsis gene encoding high-affinity potassium transport activity.1998 · DOI: 10.1105/tpc.10.1.51

Rice

Reference gene ID	Possible function	Papers / DOI
`Os09g0448200`	High-affinity potassium transporter.	No verified direct reference in this release
`Os08g0466200`	High-affinity potassium transporter.	No verified direct reference in this release
`Os08g0510300`	High-affinity potassium transporter.	No verified direct reference in this release
`Os01g0932500`	High-affinity potassium transporter.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_015698 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006813 potassium ion transport Biological Process

GO:0005886 plasma membrane Cellular Component

GO:0016020 membrane Cellular Component

GO:0015079 potassium ion transmembrane transporter activity Molecular Function

KEGG gene cross-reference

ath:AT2G30070

dosa:Os01g0932500

dosa:Os08g0466200

dosa:Os08g0510300

dosa:Os09g0448200

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.451

Rank 1 · LXL04_015698 · OH-1004

Lysosome / Vacuole0.328

Rank 2 · LXL04_015698 · OH-1004

Cytoplasm0.153

Rank 3 · LXL04_015698 · OH-1004

Endoplasmic reticulum0.112

Rank 4 · LXL04_015698 · OH-1004

Golgi apparatus0.088

Rank 5 · LXL04_015698 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF02705.23K_trans50-330 aa

PF02705.23K_trans338-544 aa

PF22776.1K_trans_C573-734 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_015698	`PF02705.23`	K_trans	50	330	4.2e-144	481.2
LXL04_015698	`PF02705.23`	K_trans	338	544	4.2e-144	481.2
LXL04_015698	`PF22776.1`	K_trans_C	573	734	2.6e-15	57.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O22397`	Arabidopsis thaliana	Potassium transporter 1	38.202%	Swiss-Prot	moderate database homology
`Q67UC7`	Oryza sativa subsp. japonica	Probable potassium transporter 17	62.979%	Swiss-Prot	strong database homology
`Q6YSA9`	Oryza sativa subsp. japonica	Probable potassium transporter 4	60.942%	Swiss-Prot	strong database homology
`Q84YJ9`	Oryza sativa subsp. japonica	Potassium transporter 26	44.300%	Swiss-Prot	moderate database homology
`Q5JMH0`	Oryza sativa subsp. japonica	Potassium transporter 6	43.830%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card