TkA02G298400 | RubberDandelionOmics

Gene overview

TkA02G298400

Reference: TK1151 Chr: Chr02 Coordinates: 76032243-76035130 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1562 bp · TkA02G298400|TK1151|cDNA

AGAAAGTTCATTGAAAAAGCTAAATGGTTTTAAAGCTTAAAAGAAAGTTATTTCACAAAGTAACCTGCTTTTTCCCTTCTCATCTCTCCTTCTCTCTATCTCTCTATATCTCTTTCTCTCTCTCTCTCTCTCTCATGAATAAAGCTGATGCAAACAACTACGCCCACTTCTACCTTCTGTACATAACCAAACCATTTTGATTGATTCGTAGCTTCATCTGTAAGATATTGGATATTATCACTGAAACCCACTACCATACA...

CDS

Download CDS FASTA

1080 bp · TkA02G298400|TK1151|CDS

ATGTTAGAGACCGACCACCCTTCACCTGCTCCATCTTCGTCAGATCATGCACTTTCTTGTAAGAGAAAAAGACGCCCCGCTGGTACTCCAGATCCAGATGCGGAGGTTGTGTCGTTATCTCCAAAGACTTTGCTGGAGTCAGACCGATACGTGTGTGAGATCTGTAACCAAGGCTTCCAGAGGGATCAGAATCTGCAGATGCACCGGCGGCGGCACAAGGTTCCATGGAAGCTGTTGAAGAGGGAATCGGCGGAGGTAAA...

Protein

Download Protein FASTA

359 aa · TkA02G298400|TK1151|PROTEIN

MLETDHPSPAPSSSDHALSCKRKRRPAGTPDPDAEVVSLSPKTLLESDRYVCEICNQGFQRDQNLQMHRRRHKVPWKLLKRESAEVKKRVFVCPEPSCLHHDPCHALGDLVGIKKHFRRKHSNNKQWVCEKCSKGYAVQSDYKAHLKTCGTRGHSCDCGRVFSRVESFIEHQDACDVRHVHPDLKAFQPACLPRMQQTHHHHKSDEHSQAHEEKIELQLLPSSSLFEQKNNHQTHLNLSIGNEVISFHKEEERIKMAMAE...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G298400`
TK1151 ID	TkA02G298400
OH-1004 ID	LXL04_022467
Relationship / confidence	Multi Candidate From Tk1151 / Complex relationship
Protein identity (%)	69.800
Protein coverage (%)	TK1151 96.657 / OH-1004 91.899 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G298400

Location Chr02:76032243-76035130 (+)

Description Similar to SGR5: Zinc finger protein SHOOT GRAVITROPISM 5

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g68130`	Transcription factor regulating starch metabolism by binding directly to the promoter of QQS.	Two splice variants of the IDD14 transcription factor competitively form nonfunctional heterodimers which may regulate starch metabolism.2011 · DOI: 10.1038/ncomms1303 The arabidopsis IDD14, IDD15, and IDD16 cooperatively regulate lateral organ morphogenesis and gravitropism by promoting auxin biosynthesis and transport.2013 · DOI: 10.1371/journal.pgen.1003759
`At2g01940`	Transcription factor involved in inflorescence stems gravitropism, probably by regulating starch accumulation in amyloplasts of graviperceptive cells.	A C2H2-type zinc finger protein, SGR5, is involved in early events of gravitropism in Arabidopsis inflorescence stems.2006 · DOI: 10.1111/j.1365-313x.2006.02807.x Altered gravitropic response, amyloplast sedimentation and circumnutation in the Arabidopsis shoot gravitropism 5 mutant are associated with reduced starch levels.2008 · DOI: 10.1007/s11103-008-9301-0 The arabidopsis IDD14, IDD15, and IDD16 cooperatively regulate lateral organ morphogenesis and gravitropism by promoting auxin biosynthesis and transport.2013 · DOI: 10.1371/journal.pgen.1003759 Mutations in the SGR4, SGR5 and SGR6 loci of Arabidopsis thaliana alter the shoot gravitropism.1997 · DOI: 10.1093/oxfordjournals.pcp.a029201
`At1g25250`	Transcription factor regulating lateral organ morphogenesis and gravitropic responses.	The arabidopsis IDD14, IDD15, and IDD16 cooperatively regulate lateral organ morphogenesis and gravitropism by promoting auxin biosynthesis and transport.2013 · DOI: 10.1371/journal.pgen.1003759
`At3g50700`	Transcription factor that acts as a positive regulator of gibberellin (GA) action, homeostasis and signaling.	No verified direct reference in this release
`At1g03840`	Transcription factor that regulates tissue boundaries and asymmetric cell division.	DELLA protein functions as a transcriptional activator through the DNA binding of the indeterminate domain family proteins.2014 · DOI: 10.1073/pnas.1321669111

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_022467 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0002221 pattern recognition receptor signaling pathway Biological Process

GO:0006351 DNA-templated transcription Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0008356 asymmetric cell division Biological Process

GO:0009590 detection of gravity Biological Process

GO:0009630 gravitropism Biological Process

GO:0009740 gibberellic acid mediated signaling pathway Biological Process

GO:0009937 regulation of gibberellic acid mediated signaling pathway Biological Process

GO:0009959 negative gravitropism Biological Process

GO:0009965 leaf morphogenesis Biological Process

GO:0010031 circumnutation Biological Process

GO:0010336 gibberellic acid homeostasis Biological Process

KEGG gene cross-reference

ath:AT1G25250

ath:AT1G68130

ath:AT2G01940

ath:AT2G02080

ath:AT3G50700

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.963

Rank 1 · TkA02G298400 · TK1151

Cytoplasm0.107

Rank 2 · TkA02G298400 · TK1151

Cell membrane0.024

Rank 3 · TkA02G298400 · TK1151

Mitochondrion0.012

Rank 4 · TkA02G298400 · TK1151

Endoplasmic reticulum0.011

Rank 5 · TkA02G298400 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF26295PDDEXK_1729-71 aa

PF26040Zn_ribbon_CLPX_N42-57 aa

PF23250zf_DPOE_246-62 aa

PF14369Zn_ribbon_1947-59 aa

PF13465zf-H2C2_248-59 aa

PF22995C2CH-3rd_BIRD-IDD49-56 aa

PF13912zf-C2H2_649-73 aa

PF00096zf-C2H250-72 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G298400	`PF26295`	PDDEXK_17	29	71	0.27	12.4
TkA02G298400	`PF26040`	Zn_ribbon_CLPX_N	42	57	0.31	11.6
TkA02G298400	`PF23250`	zf_DPOE_2	46	62	0.0019	18.6
TkA02G298400	`PF14369`	Zn_ribbon_19	47	59	1.3	10.0
TkA02G298400	`PF13465`	zf-H2C2_2	48	59	0.018	16.1
TkA02G298400	`PF22995`	C2CH-3rd_BIRD-IDD	49	56	1.7e-14	53.9
TkA02G298400	`PF13912`	zf-C2H2_6	49	73	0.00038	21.1
TkA02G298400	`PF00096`	zf-C2H2	50	72	2.6e-07	31.4
TkA02G298400	`PF17772`	zf-MYST	50	70	0.0018	18.6
TkA02G298400	`PF13894`	zf-C2H2_4	50	72	0.021	16.2
TkA02G298400	`PF12874`	zf-met	50	68	0.022	15.8
TkA02G298400	`PF23447`	DUF7128	50	68	2.5	8.8
TkA02G298400	`PF12171`	zf-C2H2_jaz	50	70	4.7	8.2
TkA02G298400	`PF13717`	Zn_ribbon_4	52	59	0.55	10.9
TkA02G298400	`PF23550`	zf_Tbcl_Rhp7	52	59	3.0	8.2
TkA02G298400	`PF13465`	zf-H2C2_2	64	74	0.018	16.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9C9X7`	Arabidopsis thaliana	sp\|Q9C9X7\|IDD14_ARATH Protein indeterminate-domain 14	53.200%	Swiss-Prot	High
`F4IPE3`	Arabidopsis thaliana	sp\|F4IPE3\|IDD15_ARATH Zinc finger protein SHOOT GRAVITROPISM 5	54.300%	Swiss-Prot	High
`Q9FRH4`	Arabidopsis thaliana	sp\|Q9FRH4\|IDD16_ARATH Protein indeterminate-domain 16	87.700%	Swiss-Prot	Low
`Q9SCQ6`	Arabidopsis thaliana	sp\|Q9SCQ6\|IDD2_ARATH Zinc finger protein GAI-ASSOCIATED FACTOR 1	60.000%	Swiss-Prot	Low
`Q9ZWA6`	Arabidopsis thaliana	sp\|Q9ZWA6\|IDD3_ARATH Zinc finger protein MAGPIE	66.000%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card