TkA02G287410 | RubberDandelionOmics

Gene overview

TkA02G287410

Reference: TK1151 Chr: Chr02 Coordinates: 73420421-73425562 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

4426 bp · TkA02G287410|TK1151|cDNA

ATAAAAGGTTAGTTTTCCGACGGAGGGCATGGAAGAGGGTGAGTTCCCGGCCACTTGAATGCATGATTGATTCTGCCATTAGTAAATCTCATGTCCAAACCTTTTTTTTCCTTAAACAACTCACCACACTATCTTTCCCCTTTTCTTTTCTTCCCAGGACGGCAATCCCTTTTTCAATCTGTCTGCGATCCACCGTTGCACCCACTACCAGTTTTCGTCTATTTTAGGAAAAATGTCTTTGGATCTTCCTCCCTCGCATC...

CDS

Download CDS FASTA

3477 bp · TkA02G287410|TK1151|CDS

ATGAATTTAGATGATTCCCAGATTGTCAATGATAACTCCCAACAACAATCACCGAATACCTTGCAAGATTCCTCTTCCGAAGGAGAGATTCGGTCCAAAACTTGGAGCGCCAACTCAGTCTTCGTCAATCTGGGATCAAAGAGACTGTCGCATGGATCTAGAGGAGGCGCCACTGATTCCGAGGCGTTTAGCATGTCCCACAGAGAAATCAACGTTGAGGATGCAAGGTTAGTGTATGTAAACGATGCCTTAAAGACAAA...

Protein

Download Protein FASTA

1158 aa · TkA02G287410|TK1151|PROTEIN

MNLDDSQIVNDNSQQQSPNTLQDSSSEGEIRSKTWSANSVFVNLGSKRLSHGSRGGATDSEAFSMSHREINVEDARLVYVNDALKTNERFEFAGNSIRTAKYSVLSFLPRNLFEQFHRVAYIYFLIIAILNQLPQLAVFGRGASILPLSVVLLVTAVKDAYEDWRRHKSDRIENNRMSSVLVNDRFEQKKCKDIQVGEIIKFSADDTIPSDIVLLSTSDPTGVAYIQTINLDGESNLKTRYAKQETLSRTPEKDMINGII...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G287410`
TK1151 ID	TkA02G287410
OH-1004 ID	LXL04_015772
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	98.900
Protein coverage (%)	TK1151 99.396 / OH-1004 96.479 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G287410

Location Chr02:73420421-73425562 (-)

Description Similar to ALA1: Phospholipid-transporting ATPase 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g04930`	Involved in transport of phospholipids.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_015772 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006892 post-Golgi vesicle-mediated transport Biological Process

GO:0007030 Golgi organization Biological Process

GO:0030335 positive regulation of cell migration Biological Process

GO:0032456 endocytic recycling Biological Process

GO:0034220 monoatomic ion transmembrane transport Biological Process

GO:0045332 phospholipid translocation Biological Process

GO:0061092 positive regulation of phospholipid translocation Biological Process

GO:0140331 aminophospholipid translocation Biological Process

GO:0005783 endoplasmic reticulum Cellular Component

GO:0005789 endoplasmic reticulum membrane Cellular Component

GO:0005794 Golgi apparatus Cellular Component

GO:0005802 trans-Golgi network Cellular Component

KEGG gene cross-reference

ath:AT5G04930

hsa:10396

hsa:79895

mmu:11980

spo:2541239

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.324

Rank 1 · TkA02G287410 · TK1151

Endoplasmic reticulum0.277

Rank 2 · TkA02G287410 · TK1151

Golgi apparatus0.214

Rank 3 · TkA02G287410 · TK1151

Lysosome / Vacuole0.213

Rank 4 · TkA02G287410 · TK1151

Cytoplasm0.192

Rank 5 · TkA02G287410 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF16209PhoLip_ATPase_N78-144 aa

PF00122E1-E2_ATPase176-250 aa

PF16212PhoLip_ATPase_C389-409 aa

PF16209PhoLip_ATPase_N396-407 aa

PF00702Hydrolase458-476 aa

PF13246Cation_ATPase561-728 aa

PF00702Hydrolase689-757 aa

PF08282Hydrolase_3733-759 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G287410	`PF16209`	PhoLip_ATPase_N	78	144	1.4e-24	86.3
TkA02G287410	`PF00122`	E1-E2_ATPase	176	250	0.00048	20.6
TkA02G287410	`PF16212`	PhoLip_ATPase_C	389	409	4.1e-73	246.9
TkA02G287410	`PF16209`	PhoLip_ATPase_N	396	407	1.4e-24	86.3
TkA02G287410	`PF00702`	Hydrolase	458	476	5.6e-08	34.1
TkA02G287410	`PF13246`	Cation_ATPase	561	728	4.5e-11	43.6
TkA02G287410	`PF00702`	Hydrolase	689	757	5.6e-08	34.1
TkA02G287410	`PF08282`	Hydrolase_3	733	759	0.0004	20.9
TkA02G287410	`PF08282`	Hydrolase_3	851	879	0.0004	20.9
TkA02G287410	`PF00702`	Hydrolase	857	875	5.6e-08	34.1
TkA02G287410	`PF16212`	PhoLip_ATPase_C	889	1128	4.1e-73	246.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`P98204`	Arabidopsis thaliana	sp\|P98204\|ALA1_ARATH Phospholipid-transporting ATPase 1	69.800%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card