TkA02G282680 | RubberDandelionOmics

Gene overview

TkA02G282680

Reference: TK1151 Chr: Chr02 Coordinates: 72122250-72125130 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

324 bp · TkA02G282680|TK1151|cDNA

ATGATTGAGTTGCAACTCAAACAGATTTTTGAAGCTTTTGGTCCTGTTGAGGTTGTTCAACTCCCCACTGACCCTGAGACAGGGCACTGTAATGGTTTTGGATTTGTTCAATTTGCTCAACTTGAACATGCAAAAGCAGCACAAAGTTTGAACGAGAAGCTTCAGATTGCTGGCCGGACAATTAAGGTATCTTCAGTTGTGGATCATGTTAGTGCACAAGACACTGGAGCAAAATCAGCAGACTTTGATGATGATGATGG...

CDS

Download CDS FASTA

324 bp · TkA02G282680|TK1151|CDS

ATGATTGAGTTGCAACTCAAACAGATTTTTGAAGCTTTTGGTCCTGTTGAGGTTGTTCAACTCCCCACTGACCCTGAGACAGGGCACTGTAATGGTTTTGGATTTGTTCAATTTGCTCAACTTGAACATGCAAAAGCAGCACAAAGTTTGAACGAGAAGCTTCAGATTGCTGGCCGGACAATTAAGGTATCTTCAGTTGTGGATCATGTTAGTGCACAAGACACTGGAGCAAAATCAGCAGACTTTGATGATGATGATGG...

Protein

Download Protein FASTA

107 aa · TkA02G282680|TK1151|PROTEIN

MIELQLKQIFEAFGPVEVVQLPTDPETGHCNGFGFVQFAQLEHAKAAQSLNEKLQIAGRTIKVSSVVDHVSAQDTGAKSADFDDDDGGGLVSQHGFLLTTRFSVLNS

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G282680`
TK1151 ID	TkA02G282680
OH-1004 ID	LXL04_015784
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	91.200
Protein coverage (%)	TK1151 85.047 / OH-1004 15.717 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA02G282680`
Location	Chr02:72122250-72125130 (-)
Description	Similar to Rbm39: RNA-binding protein 39
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_015784` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0000245 spliceosomal complex assembly Biological Process GO:0000398 mRNA splicing, via spliceosome Biological Process GO:0006351 DNA-templated transcription Biological Process GO:0006357 regulation of transcription by RNA polymerase II Biological Process GO:0006396 RNA processing Biological Process GO:0006397 mRNA processing Biological Process GO:0008380 RNA splicing Biological Process GO:0031397 negative regulation of protein ubiquitination Biological Process GO:0033120 positive regulation of RNA splicing Biological Process GO:0045292 mRNA cis splicing, via spliceosome Biological Process GO:0045893 positive regulation of DNA-templated transcription Biological Process GO:0048024 regulation of mRNA splicing, via spliceosome Biological Process
KEGG gene cross-reference	hsa:55147 hsa:9584 mmu:170791 mmu:22185 spo:2542545 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.518

Rank 1 · TkA02G282680 · TK1151

Nucleus0.498

Rank 2 · TkA02G282680 · TK1151

Cell membrane0.071

Rank 3 · TkA02G282680 · TK1151

Mitochondrion0.064

Rank 4 · TkA02G282680 · TK1151

Endoplasmic reticulum0.059

Rank 5 · TkA02G282680 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00076RRM_14-62 aa

PF25015RBD_AKAP-17A5-23 aa

PF26250RRM_RdRP1_219-57 aa

PF25015RBD_AKAP-17A40-78 aa

PF26250RRM_RdRP1_260-74 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G282680	`PF00076`	RRM_1	4	62	1.3e-14	54.5
TkA02G282680	`PF25015`	RBD_AKAP-17A	5	23	0.33	11.1
TkA02G282680	`PF26250`	RRM_RdRP1_2	19	57	0.14	13.4
TkA02G282680	`PF25015`	RBD_AKAP-17A	40	78	0.33	11.1
TkA02G282680	`PF26250`	RRM_RdRP1_2	60	74	0.14	13.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card