TkA02G186140 | RubberDandelionOmics

Gene overview

TkA02G186140

Reference: TK1151 Chr: Chr02 Coordinates: 47854755-47858106 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2445 bp · TkA02G186140|TK1151|cDNA

CCCGTCAACAAACCCTAACTCTACTACTCTTTATATACCCTTTCCGCCTCCTCTCCCGATCTACTCCATCACCAAGTTCTCAGCCAAAGATCCAAAACTCTCGTCCTTCTACACTGTGATTCTTTGTCTATCGAAGAAACAAATCAATGGCGGACACAGAGACGTTTGCCTTTCAAGCGGAGATCAACCAGCTGTTGAGTCTTATCATCAACACCTTTTACAGTAACAAGGAGATCTTTCTCCGTGAGCTTATCAGTAAC...

CDS

Download CDS FASTA

2097 bp · TkA02G186140|TK1151|CDS

ATGGCGGACACAGAGACGTTTGCCTTTCAAGCGGAGATCAACCAGCTGTTGAGTCTTATCATCAACACCTTTTACAGTAACAAGGAGATCTTTCTCCGTGAGCTTATCAGTAACTCATCCGATGCTCTGGACAAGATTCGCTTTGAGAGCTTGACTGATAAGAGCAAGCTAGATGGCCAGCCGGAGCTTTTTATCCACATTATCCCTGACAAAGCATCCAACACATTGACAATCATTGACAGCGGAGTTGGAATGACTAA...

Protein

Download Protein FASTA

698 aa · TkA02G186140|TK1151|PROTEIN

MADTETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDGQPELFIHIIPDKASNTLTIIDSGVGMTKADLVNNLGTIARSGTKEFMEAITAGADVSMIGQFGVGFYSAYLVADKVVVTTKHNDDEQYVWESQAGGSFTVTRDTSGEVLGRGTKMTLYLKEDQLEYLEERRLKDLIKKHSEFISYPISLWVEKTTEKEISDDEDEEEKKDEEGKVEEVDEEKEKEEKKKKTIKEVSHEWSL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G186140`
TK1151 ID	TkA02G186140
OH-1004 ID	LXL04_016133
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G186140

Location Chr02:47854755-47858106 (-)

Description Similar to HSC80: Heat shock cognate protein 80

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g56030`	Molecular chaperone.	No verified direct reference in this release
`At5g56010`	Functions as a holding molecular chaperone (holdase) which stabilizes unfolding protein intermediates and rapidly releases them in an active form once stress has abated.	No verified direct reference in this release
`At5g56000`	Molecular chaperone which stabilizes unfolding protein intermediates and functions as a folding molecular chaperone that assists the non-covalent folding of proteins in an ATP-dependent manner.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`UniProt: A2YWQ1`	Molecular chaperone that promotes the maturation, structural maintenance and proper regulation of specific target proteins involved for instance in cell cycle control and signal transduction.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_016133 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006457 protein folding Biological Process

GO:0006952 defense response Biological Process

GO:0009408 response to heat Biological Process

GO:0009414 response to water deprivation Biological Process

GO:0009651 response to salt stress Biological Process

GO:0009908 flower development Biological Process

GO:0010187 negative regulation of seed germination Biological Process

GO:0010286 heat acclimation Biological Process

GO:0034605 cellular response to heat Biological Process

GO:0042742 defense response to bacterium Biological Process

GO:0045087 innate immune response Biological Process

GO:0048366 leaf development Biological Process

KEGG gene cross-reference

ath:AT5G56000

ath:AT5G56030

dosa:Os09g0482100

osa:9267802

sly:543903

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.743

Rank 1 · TkA02G186140 · TK1151

Nucleus0.280

Rank 2 · TkA02G186140 · TK1151

Endoplasmic reticulum0.094

Rank 3 · TkA02G186140 · TK1151

Cell membrane0.091

Rank 4 · TkA02G186140 · TK1151

Extracellular0.060

Rank 5 · TkA02G186140 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF25794SACS13-139 aa

PF02518HATPase_c29-181 aa

PF13589HATPase_c_330-145 aa

PF00183HSP90184-681 aa

PF10158LOH1CR12373-414 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G186140	`PF25794`	SACS	13	139	0.00078	20.0
TkA02G186140	`PF02518`	HATPase_c	29	181	1e-06	29.8
TkA02G186140	`PF13589`	HATPase_c_3	30	145	3.1e-08	34.4
TkA02G186140	`PF00183`	HSP90	184	681	4e-239	795.6
TkA02G186140	`PF10158`	LOH1CR12	373	414	0.016	16.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`P55737`	Arabidopsis thaliana	sp\|P55737\|HS902_ARATH Heat shock protein 90-2	92.300%	Swiss-Prot	High
`P51818`	Arabidopsis thaliana	sp\|P51818\|HS903_ARATH Heat shock protein 90-3	92.100%	Swiss-Prot	High
`O03986`	Arabidopsis thaliana	sp\|O03986\|HS904_ARATH Heat shock protein 90-4	91.300%	Swiss-Prot	High
`A2YWQ1`	Oryza sativa subsp. indica	sp\|A2YWQ1\|HSP81_ORYSI Heat shock protein 81-1	91.700%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card