LXL04_016133 | RubberDandelionOmics

Gene overview

LXL04_016133

Reference: OH-1004 Chr: Chr03 Coordinates: 111790695-111793694 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2097 bp · LXL04_016133|LXL04_016133|OH1004|cDNA

ATGGCGGACACAGAGACGTTTGCCTTTCAAGCGGAGATCAACCAGCTGTTGAGTCTTATCATCAACACCTTTTACAGTAACAAGGAGATCTTTCTCCGTGAGCTTATCAGTAACTCATCCGATGCTCTGGACAAGATTCGCTTTGAGAGCTTGACTGATAAGAGCAAGCTAGATGGCCAGCCGGAGCTTTTTATCCACATTATCCCTGACAAAGCATCCAACACATTGACAATCATTGACAGCGGAGTTGGAATGACTAA...

CDS

Download CDS FASTA

2097 bp · LXL04_016133|LXL04_016133|OH1004|CDS

ATGGCGGACACAGAGACGTTTGCCTTTCAAGCGGAGATCAACCAGCTGTTGAGTCTTATCATCAACACCTTTTACAGTAACAAGGAGATCTTTCTCCGTGAGCTTATCAGTAACTCATCCGATGCTCTGGACAAGATTCGCTTTGAGAGCTTGACTGATAAGAGCAAGCTAGATGGCCAGCCGGAGCTTTTTATCCACATTATCCCTGACAAAGCATCCAACACATTGACAATCATTGACAGCGGAGTTGGAATGACTAA...

Protein

Download Protein FASTA

698 aa · LXL04_016133|LXL04_016133|OH1004|PROTEIN

MADTETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFESLTDKSKLDGQPELFIHIIPDKASNTLTIIDSGVGMTKADLVNNLGTIARSGTKEFMEAITAGADVSMIGQFGVGFYSAYLVADKVVVTTKHNDDEQYVWESQAGGSFTVTRDTSGEVLGRGTKMTLYLKEDQLEYLEERRLKDLIKKHSEFISYPISLWVEKTTEKEISDDEDEEEKKDEEGKVEEVDEEKEKEEKKKKTIKEVSHEWSL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_016133`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_016133

Location Chr03:111790695-111793694 (+)

Description Similar to HSC80: Heat shock cognate protein 80

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g56000`	Molecular chaperone which stabilizes unfolding protein intermediates and functions as a folding molecular chaperone that assists the non-covalent folding of proteins in an ATP-dependent manner.	No verified direct reference in this release
`At5g56030`	Molecular chaperone.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os09g0482100`	Molecular chaperone that promotes the maturation, structural maintenance and proper regulation of specific target proteins involved for instance in cell cycle control and signal transduction.	No verified direct reference in this release
`UniProt: Q07078`	Molecular chaperone that promotes the maturation, structural maintenance and proper regulation of specific target proteins involved for instance in cell cycle control and signal transduction.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_016133 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006457 protein folding Biological Process

GO:0006952 defense response Biological Process

GO:0009408 response to heat Biological Process

GO:0009414 response to water deprivation Biological Process

GO:0009651 response to salt stress Biological Process

GO:0009908 flower development Biological Process

GO:0010187 negative regulation of seed germination Biological Process

GO:0010286 heat acclimation Biological Process

GO:0034605 cellular response to heat Biological Process

GO:0042742 defense response to bacterium Biological Process

GO:0045087 innate immune response Biological Process

GO:0048366 leaf development Biological Process

KEGG gene cross-reference

ath:AT5G56000

ath:AT5G56030

dosa:Os09g0482100

osa:9267802

sly:543903

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.743

Rank 1 · LXL04_016133 · OH-1004

Nucleus0.280

Rank 2 · LXL04_016133 · OH-1004

Endoplasmic reticulum0.094

Rank 3 · LXL04_016133 · OH-1004

Cell membrane0.091

Rank 4 · LXL04_016133 · OH-1004

Extracellular0.060

Rank 5 · LXL04_016133 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF02518.32HATPase_c29-181 aa

PF13589.13HATPase_c_330-145 aa

PF00183.24HSP90184-681 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_016133	`PF02518.32`	HATPase_c	29	181	1e-06	29.8
LXL04_016133	`PF13589.13`	HATPase_c_3	30	145	3.1e-08	34.4
LXL04_016133	`PF00183.24`	HSP90	184	681	4e-239	795.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O03986`	Arabidopsis thaliana	Heat shock protein 90-4	91.143%	Swiss-Prot	strong database homology
`P55737`	Arabidopsis thaliana	Heat shock protein 90-2	92.571%	Swiss-Prot	strong database homology
`Q69QQ6`	Oryza sativa subsp. japonica	Heat shock protein 81-2	89.413%	Swiss-Prot	strong database homology
`Q07078`	Oryza sativa subsp. japonica	Heat shock protein 81-3	89.270%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card