TkA02G160590 | RubberDandelionOmics

Gene overview

TkA02G160590

Reference: TK1151 Chr: Chr02 Coordinates: 41186672-41189484 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1613 bp · TkA02G160590|TK1151|cDNA

CTCCGTATCTCCATTTGACAGCCAAAATGACTCCAATCTTCCTCGACGTCAAGCTCTCGCTTCCTCCATTCTCGGTCAATGAAGCTCGTGGATCATCTCCAACAGATTTCCCCCTCTATCGGTCTTCATGGCGTCGGCGACTGGTTCTTACCTCCGGATTTTCTCCCTCAAATCTGATTCATAGCTCGCCTCTATTGACTTCCAAATCGACCTCAAGCTTGTTTCAATCGATTCCTCCATTCTCGGTCAATGAAGCTCGT...

CDS

Download CDS FASTA

747 bp · TkA02G160590|TK1151|CDS

ATGTTTGGTGTTTTCCGGCGAAGAGTTGTTAGCGGAAGCTCCTCTGCTTCGGTGTTACTCCATCCAAGAATTGTTGGAAAAGATCAAATTGTATGCCATACTGTCCAAAGTGGTGCAGTGAATTTAAGGCCATTAAGGAAAGTTATGACCAGTCTTAAGCCATGTGTCAGCATGCAAATTCAATCCAGAATGTTCTCCTCTGACAGTGGTGACCTGGTTGATGTTGCTGTCCCTTTTATGGGTGAATCTATAAGTTATGG...

Protein

Download Protein FASTA

248 aa · TkA02G160590|TK1151|PROTEIN

MFGVFRRRVVSGSSSASVLLHPRIVGKDQIVCHTVQSGAVNLRPLRKVMTSLKPCVSMQIQSRMFSSDSGDLVDVAVPFMGESISYGTLATFLKKTGEMVEVNEPIAQVKTDMVTINVASPEVGVIQEVNIINVASPEAGVIQEFVVKEGDSVESGTKIAIISKSAAASPSPPKDETDPGGIKEEMKEMKKKMDEILDNLAVRKEMKEMKKELESDALGLRKEIKIIQECTSFHGIGFLILIIYWFMK

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G160590`
TK1151 ID	TkA02G160590
OH-1004 ID	LXL04_016294
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	80.700
Protein coverage (%)	TK1151 87.903 / OH-1004 26.720 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G160590

Location Chr02:41186672-41189484 (-)

Description Similar to At4g26910: Dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex 2, mitochondrial

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g26910`	The 2-oxoglutarate dehydrogenase complex catalyzes the overall conversion of 2-oxoglutarate to succinyl-CoA and CO(2).	No verified direct reference in this release
`At5g55070`	The 2-oxoglutarate dehydrogenase complex catalyzes the overall conversion of 2-oxoglutarate to succinyl-CoA and CO(2).	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_016294 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006099 tricarboxylic acid cycle Biological Process

GO:0006103 2-oxoglutarate metabolic process Biological Process

GO:0006104 succinyl-CoA metabolic process Biological Process

GO:0033512 L-lysine catabolic process to acetyl-CoA via L-saccharopine Biological Process

GO:0005634 nucleus Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005759 mitochondrial matrix Cellular Component

GO:0005829 cytosol Cellular Component

GO:0009536 plastid Cellular Component

GO:0022626 cytosolic ribosome Cellular Component

GO:0045252 oxoglutarate dehydrogenase complex Cellular Component

GO:0004149 dihydrolipoyllysine-residue succinyltransferase activity Molecular Function

KEGG gene cross-reference

ath:AT4G26910

ath:AT5G55070

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Mitochondrion0.862

Rank 1 · TkA02G160590 · TK1151

Plastid0.095

Rank 2 · TkA02G160590 · TK1151

Cytoplasm0.077

Rank 3 · TkA02G160590 · TK1151

Nucleus0.044

Rank 4 · TkA02G160590 · TK1151

Cell membrane0.022

Rank 5 · TkA02G160590 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF25917BSH_RND53-67 aa

PF00364Biotin_lipoyl74-130 aa

PF01551Peptidase_M2382-111 aa

PF26018BSH_RND_rel85-126 aa

PF25997BSH_YhbJ86-126 aa

PF25984BSH_YknX86-130 aa

PF13375RnfC_N86-138 aa

PF25973BSH_CzcB87-163 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G160590	`PF25917`	BSH_RND	53	67	0.8	10.3
TkA02G160590	`PF00364`	Biotin_lipoyl	74	130	1.9e-12	47.5
TkA02G160590	`PF01551`	Peptidase_M23	82	111	0.0014	19.5
TkA02G160590	`PF26018`	BSH_RND_rel	85	126	1.3e-06	28.9
TkA02G160590	`PF25997`	BSH_YhbJ	86	126	2.9e-07	31.1
TkA02G160590	`PF25984`	BSH_YknX	86	130	1.2e-06	28.9
TkA02G160590	`PF13375`	RnfC_N	86	138	0.00017	22.3
TkA02G160590	`PF25973`	BSH_CzcB	87	163	1.8e-06	28.5
TkA02G160590	`PF07831`	PYNP_C	91	109	0.0065	16.8
TkA02G160590	`PF25919`	BSH_CusB	94	162	2.1e-07	31.4
TkA02G160590	`PF25917`	BSH_RND	95	162	0.8	10.3
TkA02G160590	`PF11987`	IF-2	102	153	5.2	7.7
TkA02G160590	`PF25997`	BSH_YhbJ	130	164	2.9e-07	31.1
TkA02G160590	`PF25973`	BSH_CzcB	132	200	1.8e-06	28.5
TkA02G160590	`PF00364`	Biotin_lipoyl	133	162	1.9e-12	47.5
TkA02G160590	`PF26018`	BSH_RND_rel	134	183	1.3e-06	28.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8H107`	Arabidopsis thaliana	sp\|Q8H107\|ODO2B_ARATH Dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex 2, mitochondrial	52.300%	Swiss-Prot	Low
`Q9FLQ4`	Arabidopsis thaliana	sp\|Q9FLQ4\|ODO2A_ARATH Dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex 1, mitochondrial	60.900%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card