TkA02G156020 | RubberDandelionOmics

Gene overview

TkA02G156020

Reference: TK1151 Chr: Chr02 Coordinates: 40033128-40035748 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1869 bp · TkA02G156020|TK1151|cDNA

GGAAGGAATTTTTTTGATCGTTACCAAATTCTTCTAAAAGTCTGCCAGCCCTTCCTTCCCCACTTCCCCAAAAACCCAAAACCAAAAAAGATATATAAATCAGTCCCTCGTCTTCACTCATTTCTAAACCCCATTTCCACTTTCTTGCAATACAGACCGCCATCGCACAAAACCCTCGACCCGTACTCGATAAAGATTGATCATGCTTTGTTCGATTCAGCGAATGGTCTGCAATCCATTAACCGTCAACAAGTACAACA...

CDS

Download CDS FASTA

1407 bp · TkA02G156020|TK1151|CDS

ATGCTTTGTTCGATTCAGCGAATGGTCTGCAATCCATTAACCGTCAACAAGTACAACAAATCCCTAATCGGCGGAAATACGAGCAACTCTGACGGCATTAGTCAACTCCCGGATTGCATTCTTCATCATATCCTCTCATTTATTCCCACAAAAGACGTTGTCAAGACCTCAATACTATCAAAAAGATGGAAAAATCTCTGGACATCCGTTTCAAATCTAGACTTTGATGACGCATTACTGTACAAAGAAATGGACGGCCA...

Protein

Download Protein FASTA

468 aa · TkA02G156020|TK1151|PROTEIN

MLCSIQRMVCNPLTVNKYNKSLIGGNTSNSDGISQLPDCILHHILSFIPTKDVVKTSILSKRWKNLWTSVSNLDFDDALLYKEMDGQDPPNETSFMNFVDRVLLFCDTLNINKFRLSCRVCFNPSRIHTWISSAILHNVHELDLCLFTEDPFTLPQSIFSSISLTTLKIEMNCDLQIPSSITLPNLKTLHLSLITFPDDDLTQKLFSGCLALEELVLLDCEWTNLKNILISSSNLKRLTIDDLPYFGPPDDPGGCKITID...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G156020`
TK1151 ID	TkA02G156020
OH-1004 ID	LXL04_016325
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	97.400
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G156020

Location Chr02:40033128-40035748 (-)

Description Similar to At3g49150: Putative F-box/LRR-repeat protein At3g49150

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g49150`	Putative F-box/LRR-repeat protein At3g49150.	No verified direct reference in this release
`At3g58860`	Putative F-box protein At3g58860.	No verified direct reference in this release
`At3g59200`	F-box/LRR-repeat protein At3g59200.	No verified direct reference in this release
`At3g59190`	F-box/LRR-repeat protein At3g59190.	No verified direct reference in this release
`At3g59210`	F-box/LRR-repeat protein At3g59210.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_016325 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0030163 protein catabolic process Biological Process

GO:0005634 nucleus Cellular Component

GO:0009507 chloroplast Cellular Component

KEGG gene cross-reference

ath:AT3G58860

ath:AT3G59190

ath:AT3G59200

ath:AT4G14096

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.812

Rank 1 · TkA02G156020 · TK1151

Cytoplasm0.287

Rank 2 · TkA02G156020 · TK1151

Endoplasmic reticulum0.029

Rank 3 · TkA02G156020 · TK1151

Cell membrane0.029

Rank 4 · TkA02G156020 · TK1151

Plastid0.017

Rank 5 · TkA02G156020 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00646F-box33-72 aa

PF12937F-box-like33-66 aa

PF08387FBD35-44 aa

PF00646F-box101-119 aa

PF23622LRR_At1g61320_AtMIF1113-376 aa

PF24758LRR_At5g56370128-240 aa

PF12799LRR_4136-144 aa

PF12799LRR_4163-192 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G156020	`PF00646`	F-box	33	72	1.3e-10	41.5
TkA02G156020	`PF12937`	F-box-like	33	66	4.8e-05	23.7
TkA02G156020	`PF08387`	FBD	35	44	0.087	13.4
TkA02G156020	`PF00646`	F-box	101	119	1.3e-10	41.5
TkA02G156020	`PF23622`	LRR_At1g61320_AtMIF1	113	376	2.9e-12	47.4
TkA02G156020	`PF24758`	LRR_At5g56370	128	240	7.6e-17	62.5
TkA02G156020	`PF12799`	LRR_4	136	144	6.7	7.8
TkA02G156020	`PF12799`	LRR_4	163	192	6.7	7.8
TkA02G156020	`PF07723`	LRR_2	185	209	7.6e-05	23.9
TkA02G156020	`PF07723`	LRR_2	212	224	7.6e-05	23.9
TkA02G156020	`PF12799`	LRR_4	212	226	6.7	7.8
TkA02G156020	`PF08387`	FBD	226	240	0.087	13.4
TkA02G156020	`PF07723`	LRR_2	234	241	7.6e-05	23.9
TkA02G156020	`PF24758`	LRR_At5g56370	304	335	7.6e-17	62.5
TkA02G156020	`PF12799`	LRR_4	308	327	6.7	7.8
TkA02G156020	`PF23622`	LRR_At1g61320_AtMIF1	321	378	2.9e-12	47.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9M3B7`	Arabidopsis thaliana	sp\|Q9M3B7\|FBL54_ARATH Putative F-box/LRR-repeat protein At3g49150	36.200%	Swiss-Prot	Medium
`Q9LXR6`	Arabidopsis thaliana	sp\|Q9LXR6\|FB207_ARATH Putative F-box protein At3g58860	30.900%	Swiss-Prot	Medium
`Q9LX51`	Arabidopsis thaliana	sp\|Q9LX51\|FBL64_ARATH F-box/LRR-repeat protein At3g59200	33.900%	Swiss-Prot	Medium
`Q1PED9`	Arabidopsis thaliana	sp\|Q1PED9\|FBL63_ARATH F-box/LRR-repeat protein At3g59190	32.200%	Swiss-Prot	Medium
`Q8GW80`	Arabidopsis thaliana	sp\|Q8GW80\|FBL65_ARATH F-box/LRR-repeat protein At3g59210	33.300%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card