TkA02G131640 | RubberDandelionOmics

Gene overview

TkA02G131640

Reference: TK1151 Chr: Chr02 Coordinates: 34073699-34075881 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

909 bp · TkA02G131640|TK1151|cDNA

ATGAAACATGGCGAAAGTAATGAAGTTTTGAGAAAGTATCGGGATTTTAAAAAGTTTGATATCGTTGACGACTATTCCGATCATCACTACAAACAGCCAAACTTGGAAAACAAGCAGCCAGAAAAAAACTGGGCTAAAACTATACAACGAGAATGGAGGATTCTCGATGACGGATTGCCTGATACAATATTTGTTAGGGCTTATGAATCAAGAATGGATCTTTTACGGGCAGTGATAATAGGTCCAGAAGGGACACCATA...

CDS

Download CDS FASTA

909 bp · TkA02G131640|TK1151|CDS

ATGAAACATGGCGAAAGTAATGAAGTTTTGAGAAAGTATCGGGATTTTAAAAAGTTTGATATCGTTGACGACTATTCCGATCATCACTACAAACAGCCAAACTTGGAAAACAAGCAGCCAGAAAAAAACTGGGCTAAAACTATACAACGAGAATGGAGGATTCTCGATGACGGATTGCCTGATACAATATTTGTTAGGGCTTATGAATCAAGAATGGATCTTTTACGGGCAGTGATAATAGGTCCAGAAGGGACACCATA...

Protein

Download Protein FASTA

302 aa · TkA02G131640|TK1151|PROTEIN

MKHGESNEVLRKYRDFKKFDIVDDYSDHHYKQPNLENKQPEKNWAKTIQREWRILDDGLPDTIFVRAYESRMDLLRAVIIGPEGTPYHDGLFFFDVYFPYKYPSDPPKVRYHSRGLRINPNLYSSGTVCLSLLNTWKGNKNEKWTPGVSTMLQVLVSIQGLILNAKPYFNEPGFERSSGSPTGEYRSMLYNEQTLIYSLKTMVYTMNKPPKHFEDLVVGHFHERAVNILTICKSYTRGVGVECDVSGGVIKKGTYGFREN...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G131640`
TK1151 ID	TkA02G131640
OH-1004 ID	LXL04_009881
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	57.600
Protein coverage (%)	TK1151 91.391 / OH-1004 60.043 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G131640

Location Chr02:34073699-34075881 (+)

Description Similar to UBC38: Putative ubiquitin-conjugating enzyme E2 38

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g15355`	Accepts the ubiquitin from the E1 complex and catalyzes its covalent attachment to other proteins.	No verified direct reference in this release
`At1g53025`	Accepts the ubiquitin from the E1 complex and catalyzes its covalent attachment to other proteins.	No verified direct reference in this release
`At1g53020`	Accepts the ubiquitin from the E1 complex and catalyzes its covalent attachment to other proteins.	No verified direct reference in this release
`At1g53023`	Accepts the ubiquitin from the E1 complex and catalyzes its covalent attachment to other proteins.	No verified direct reference in this release
`At2g33770`	E2 ubiquitin-protein ligase that mediates E1-dependent protein ubiquitination.	PHO2-dependent degradation of PHO1 modulates phosphate homeostasis in Arabidopsis.2012 · DOI: 10.1105/tpc.112.096636 Nitrogen limitation adaptation, a target of microRNA827, mediates degradation of plasma membrane-localized phosphate transporters to maintain phosphate homeostasis in Arabidopsis.2013 · DOI: 10.1105/tpc.113.116012 Identification of downstream components of ubiquitin-conjugating enzyme PHOSPHATE2 by quantitative membrane proteomics in Arabidopsis roots.2013 · DOI: 10.1105/tpc.113.115998 NITROGEN LIMITATION ADAPTATION recruits PHOSPHATE2 to target the phosphate transporter PT2 for degradation during the regulation of Arabidopsis phosphate homeostasis.2014 · DOI: 10.1105/tpc.113.120311

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_009881 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0016567 protein ubiquitination Biological Process

GO:0005634 nucleus Cellular Component

GO:0005524 ATP binding Molecular Function

GO:0061631 ubiquitin conjugating enzyme activity Molecular Function

KEGG gene cross-reference

ath:AT1G53023

ath:AT1G53025

ath:AT2G16920

ath:AT3G15355

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.640

Rank 1 · TkA02G131640 · TK1151

Cytoplasm0.465

Rank 2 · TkA02G131640 · TK1151

Cell membrane0.040

Rank 3 · TkA02G131640 · TK1151

Mitochondrion0.039

Rank 4 · TkA02G131640 · TK1151

Endoplasmic reticulum0.029

Rank 5 · TkA02G131640 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00179UQ_con49-166 aa

PF05743UEV96-167 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G131640	`PF00179`	UQ_con	49	166	4.7e-24	85.3
TkA02G131640	`PF05743`	UEV	96	167	0.2	12.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LUQ5`	Arabidopsis thaliana	sp\|Q9LUQ5\|UBC25_ARATH Probable ubiquitin-conjugating enzyme E2 25	62.800%	Swiss-Prot	High
`Q8GY87`	Arabidopsis thaliana	sp\|Q8GY87\|UBC26_ARATH Probable ubiquitin-conjugating enzyme E2 26	55.700%	Swiss-Prot	High
`Q9C918`	Arabidopsis thaliana	sp\|Q9C918\|UBC38_ARATH Putative ubiquitin-conjugating enzyme E2 38	56.000%	Swiss-Prot	High
`F4HPP7`	Arabidopsis thaliana	sp\|F4HPP7\|UBC39_ARATH Putative ubiquitin-conjugating enzyme E2 39	55.300%	Swiss-Prot	High
`Q8VY10`	Arabidopsis thaliana	sp\|Q8VY10\|UBC24_ARATH Probable ubiquitin-conjugating enzyme E2 24	48.200%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card