TkA02G127520 | RubberDandelionOmics

Gene overview

TkA02G127520

Reference: TK1151 Chr: Chr02 Coordinates: 33100644-33101357 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

684 bp · TkA02G127520|TK1151|cDNA

ATGGAAATCACATCGAGATTACAAGAAAGAGAAAACCCATCTCCGGCCAACTCTCCGAACAGCCACGGCAGCAGTAGCAACAGCAATGGACATGCTGTTGGCGGTGGAGCCACCGCCCAAACCCCACCATTAACTCCAAAACCCATTTCGAGATCCGAATCCAATCCATACCCAACCACCTTCGTCCAAGCTGACACCAATAGCTTCAAACAAGTAGTTCAGATGCTAACCGGATCCTCCGAAACCGCAAAAAATCCATC...

CDS

Download CDS FASTA

684 bp · TkA02G127520|TK1151|CDS

ATGGAAATCACATCGAGATTACAAGAAAGAGAAAACCCATCTCCGGCCAACTCTCCGAACAGCCACGGCAGCAGTAGCAACAGCAATGGACATGCTGTTGGCGGTGGAGCCACCGCCCAAACCCCACCATTAACTCCAAAACCCATTTCGAGATCCGAATCCAATCCATACCCAACCACCTTCGTCCAAGCTGACACCAATAGCTTCAAACAAGTAGTTCAGATGCTAACCGGATCCTCCGAAACCGCAAAAAATCCATC...

Protein

Download Protein FASTA

227 aa · TkA02G127520|TK1151|PROTEIN

MEITSRLQERENPSPANSPNSHGSSSNSNGHAVGGGATAQTPPLTPKPISRSESNPYPTTFVQADTNSFKQVVQMLTGSSETAKNPSPAPAPAPAKVSIPPIKTGQQKKQGFKLYERRNSLKNGLMINPNSVPKFGHGSSPRFHEILSPSILDFPSLVLSPVTPLIEDPFNKSSPSIGNSSEEDRAIAEKGFYLHPSPRAATPRGTPEPQLLPLFPVTSPRVTGSPS

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G127520`
TK1151 ID	TkA02G127520
OH-1004 ID	LXL04_016531
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	88.900
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G127520

Location Chr02:33100644-33101357 (-)

Description Similar to VQ4: VQ motif-containing protein 4

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g28280`	Acts as a negative regulator of WRKY33 transcription factor activity in the promotion of defense gene expression.	The Arabidopsis thaliana mitogen-activated protein kinases MPK3 and MPK6 target a subclass of 'VQ-motif'-containing proteins to regulate immune responses.2014 · DOI: 10.1111/nph.12817
`At3g15300`	May modulate WRKY transcription factor activities.	No verified direct reference in this release
`At5g53830`	May modulate WRKY transcription factor activities.	No verified direct reference in this release
`At2g33780`	May modulate WRKY transcription factor activities.	No verified direct reference in this release
`At5g08480`	May modulate WRKY transcription factor activities.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_016531 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006952 defense response Biological Process

GO:0051245 negative regulation of cellular defense response Biological Process

GO:0005634 nucleus Cellular Component

KEGG gene cross-reference

ath:AT1G28280

ath:AT1G80450

ath:AT2G33780

ath:AT3G15300

ath:AT5G53830

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.623

Rank 1 · TkA02G127520 · TK1151

Cytoplasm0.476

Rank 2 · TkA02G127520 · TK1151

Cell membrane0.119

Rank 3 · TkA02G127520 · TK1151

Endoplasmic reticulum0.046

Rank 4 · TkA02G127520 · TK1151

Plastid0.018

Rank 5 · TkA02G127520 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF15845NICE-111-33 aa

PF05678VQ56-82 aa

PF15845NICE-178-96 aa

PF05678VQ221-227 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G127520	`PF15845`	NICE-1	11	33	5.0	8.4
TkA02G127520	`PF05678`	VQ	56	82	1e-11	44.8
TkA02G127520	`PF15845`	NICE-1	78	96	5.0	8.4
TkA02G127520	`PF05678`	VQ	221	227	1e-11	44.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q5M750`	Arabidopsis thaliana	sp\|Q5M750\|VQ4_ARATH VQ motif-containing protein 4	55.100%	Swiss-Prot	High
`Q9LDZ1`	Arabidopsis thaliana	sp\|Q9LDZ1\|VQ19_ARATH VQ motif-containing protein 19	56.100%	Swiss-Prot	High
`Q9FHZ3`	Arabidopsis thaliana	sp\|Q9FHZ3\|VQ33_ARATH VQ motif-containing protein 33	57.400%	Swiss-Prot	High
`O23660`	Arabidopsis thaliana	sp\|O23660\|VQ13_ARATH VQ motif-containing protein 13	47.600%	Swiss-Prot	Medium
`Q9FNP0`	Arabidopsis thaliana	sp\|Q9FNP0\|VQ31_ARATH VQ motif-containing protein 31	36.800%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card