LXL04_016531 | RubberDandelionOmics

Gene overview

LXL04_016531

Reference: OH-1004 Chr: Chr03 Coordinates: 126054951-126055658 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

708 bp · LXL04_016531|LXL04_016531|OH1004|cDNA

ATGGAAATCACATCGAGATTACAAGAAAGAGAAAACCCATCTCCGGCCAACTCTCCGAACAGCCACGGCAGCAGTAGCAACAGCAATGGACATGCTGGTGGCGGTGGAGCCACCGCCCAAACCCCACCATTAACTCCAAAACCCGTTTCGAGATCCgaatccaatccatacccaaCAACTTTCGTCCAAGCTGACACCAATAGCTTCAAACAAGTAGTTCAGATGCTAACCGGATCCTCCGAAACCGCAAAAAATGCTTC...

CDS

Download CDS FASTA

708 bp · LXL04_016531|LXL04_016531|OH1004|CDS

ATGGAAATCACATCGAGATTACAAGAAAGAGAAAACCCATCTCCGGCCAACTCTCCGAACAGCCACGGCAGCAGTAGCAACAGCAATGGACATGCTGGTGGCGGTGGAGCCACCGCCCAAACCCCACCATTAACTCCAAAACCCGTTTCGAGATCCGAATCCAATCCATACCCAACAACTTTCGTCCAAGCTGACACCAATAGCTTCAAACAAGTAGTTCAGATGCTAACCGGATCCTCCGAAACCGCAAAAAATGCTTC...

Protein

Download Protein FASTA

235 aa · LXL04_016531|LXL04_016531|OH1004|PROTEIN

MEITSRLQERENPSPANSPNSHGSSSNSNGHAGGGGATAQTPPLTPKPVSRSESNPYPTTFVQADTNSFKQVVQMLTGSSETAKNASSKPTRQPDPSPAPAPAKVSIPPIKTGQQKKQGFKLYERRNSLKNGLMINPNSVPKFGRGSSPRFHEILSPSILDFPSLVLSPVTPLIEDPFNKSSPSIGNSSEEDRAIAEKGFYLHPSPRAATPRGTPEPQLLPLFPVTSPRVTGSPS

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_016531`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_016531

Location Chr03:126054951-126055658 (+)

Description Similar to VQ4: VQ motif-containing protein 4

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g28280`	Acts as a negative regulator of WRKY33 transcription factor activity in the promotion of defense gene expression.	The Arabidopsis thaliana mitogen-activated protein kinases MPK3 and MPK6 target a subclass of 'VQ-motif'-containing proteins to regulate immune responses.2014 · DOI: 10.1111/nph.12817
`At3g15300`	May modulate WRKY transcription factor activities.	No verified direct reference in this release
`At5g53830`	May modulate WRKY transcription factor activities.	No verified direct reference in this release
`At2g33780`	May modulate WRKY transcription factor activities.	No verified direct reference in this release
`At1g80450`	May modulate WRKY transcription factor activities.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_016531 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006952 defense response Biological Process

GO:0051245 negative regulation of cellular defense response Biological Process

GO:0005634 nucleus Cellular Component

KEGG gene cross-reference

ath:AT1G28280

ath:AT1G80450

ath:AT2G33780

ath:AT3G15300

ath:AT5G53830

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.594

Rank 1 · LXL04_016531 · OH-1004

Cytoplasm0.495

Rank 2 · LXL04_016531 · OH-1004

Cell membrane0.138

Rank 3 · LXL04_016531 · OH-1004

Endoplasmic reticulum0.047

Rank 4 · LXL04_016531 · OH-1004

Plastid0.018

Rank 5 · LXL04_016531 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF05678.20VQ56-82 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_016531	`PF05678.20`	VQ	56	82	1.1e-11	44.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q5M750`	Arabidopsis thaliana	VQ motif-containing protein 4	56.225%	Swiss-Prot	strong database homology
`Q9LDZ1`	Arabidopsis thaliana	VQ motif-containing protein 19	55.556%	Swiss-Prot	strong database homology
`Q9FHZ3`	Arabidopsis thaliana	VQ motif-containing protein 33	53.883%	Swiss-Prot	strong database homology
`O23660`	Arabidopsis thaliana	VQ motif-containing protein 13	47.692%	Swiss-Prot	moderate database homology
`Q9M8L3`	Arabidopsis thaliana	VQ motif-containing protein 11	35.106%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card