TkA02G125320 | RubberDandelionOmics

Gene overview

TkA02G125320

Reference: TK1151 Chr: Chr02 Coordinates: 32487521-32490016 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1641 bp · TkA02G125320|TK1151|cDNA

ATTAAATTTCCATGCCTATATACAAAGAACGTGAGAACTATGGACTTCATTTCTTCATATTTTCTTACGGCAGATGTCGGAAGATACTGCTTCATTGATAGCCAAGGCGGATTCCGATGGTGGTAGAAATGGTAGTTGTCGGTGGTGGAAGAAATTATTGGATTGGGAAGAGGCTAAATTCCAGATCTTATTTTCTCTCCCTATGATACTAACAAATGTTGCATACTATTGCATACCATTAGTATCCGTCATGTTCGCCG...

CDS

Download CDS FASTA

1446 bp · TkA02G125320|TK1151|CDS

ATGTCGGAAGATACTGCTTCATTGATAGCCAAGGCGGATTCCGATGGTGGTAGAAATGGTAGTTGTCGGTGGTGGAAGAAATTATTGGATTGGGAAGAGGCTAAATTCCAGATCTTATTTTCTCTCCCTATGATACTAACAAATGTTGCATACTATTGCATACCATTAGTATCCGTCATGTTCGCCGGCCACCTCGGAGAAGCTGAGCTCGCCGCCTCTAACCTTGCAAACTCCTGGGCCACCGTCACCGGACTCTCTTT...

Protein

Download Protein FASTA

481 aa · TkA02G125320|TK1151|PROTEIN

MSEDTASLIAKADSDGGRNGSCRWWKKLLDWEEAKFQILFSLPMILTNVAYYCIPLVSVMFAGHLGEAELAASNLANSWATVTGLSFMVGLSGALETLCGQGFGAKIYRMLGIYLQTSCLISIFFSILISILWFFTEPILILLQQDPQISKLAALYIKYLIPGLFAYGLLNNILRFLQTQSIVASLVICSLVPFILHIGITFVLVRFTSLSFIGAPIAVSISLWIALIMLGGYVLFNDKFKETWQGFSIESFQHVFTGLK...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G125320`
TK1151 ID	TkA02G125320
OH-1004 ID	LXL04_016547
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.200
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G125320

Location Chr02:32487521-32490016 (-)

Description Similar to DTX18: Protein DETOXIFICATION 18

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g23550`	Protein DETOXIFICATION 18.	No verified direct reference in this release
`At3g23560`	Required for protection of the roots from inhibitory compounds.	Arabidopsis ALF5, a multidrug efflux transporter gene family member, confers resistance to toxins.2001 · DOI: 10.1105/tpc.010035
`At5g52450`	Protein DETOXIFICATION 16.	No verified direct reference in this release
`At1g73700`	Protein DETOXIFICATION 17.	No verified direct reference in this release
`At1g15170`	Protein DETOXIFICATION 12.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_016547 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0002229 defense response to oomycetes Biological Process

GO:0009624 response to nematode Biological Process

GO:0009636 response to toxic substance Biological Process

GO:0098542 defense response to other organism Biological Process

GO:1990961 xenobiotic detoxification by transmembrane export across the plasma membrane Biological Process

GO:0000325 plant-type vacuole Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009536 plastid Cellular Component

GO:0016020 membrane Cellular Component

GO:0015297 antiporter activity Molecular Function

KEGG gene cross-reference

ath:AT1G73700

ath:AT2G34360

ath:AT3G23550

ath:AT3G23560

ath:AT5G52450

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Lysosome / Vacuole0.388

Rank 1 · TkA02G125320 · TK1151

Cell membrane0.345

Rank 2 · TkA02G125320 · TK1151

Endoplasmic reticulum0.111

Rank 3 · TkA02G125320 · TK1151

Cytoplasm0.087

Rank 4 · TkA02G125320 · TK1151

Golgi apparatus0.080

Rank 5 · TkA02G125320 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01554MatE43-202 aa

PF01554MatE264-425 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G125320	`PF01554`	MatE	43	202	3.3e-59	199.9
TkA02G125320	`PF01554`	MatE	264	425	3.3e-59	199.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LUH3`	Arabidopsis thaliana	sp\|Q9LUH3\|DTX18_ARATH Protein DETOXIFICATION 18	65.600%	Swiss-Prot	High
`Q9LUH2`	Arabidopsis thaliana	sp\|Q9LUH2\|DTX19_ARATH Protein DETOXIFICATION 19	64.300%	Swiss-Prot	High
`Q9FHB6`	Arabidopsis thaliana	sp\|Q9FHB6\|DTX16_ARATH Protein DETOXIFICATION 16	44.300%	Swiss-Prot	Medium
`Q9C9U1`	Arabidopsis thaliana	sp\|Q9C9U1\|DTX17_ARATH Protein DETOXIFICATION 17	43.400%	Swiss-Prot	Medium
`Q8L731`	Arabidopsis thaliana	sp\|Q8L731\|DTX12_ARATH Protein DETOXIFICATION 12	41.400%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card