TkA02G116900 | RubberDandelionOmics

Gene overview

TkA02G116900

Reference: TK1151 Chr: Chr02 Coordinates: 30507380-30511446 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1853 bp · TkA02G116900|TK1151|cDNA

AACGGCAATGTCGGTGAACAATGGCGGGAATATACATACAATCTTTGCCATCATAATTCATAAGTCATAACACCGGCTACTGACCCAAAGCCCTAGACTTTCTGAGTTCAAATAGACATCATATTGTCTTGATTAAATTATTCATTGTTTAAGCTACACTTATGTTTTTAGTTGCTAATCTTCGCATTTCATTCTTTTCAAGAAACCCTAGGACTGCCATATTTGCTCTTCATACAGTGCCATCGCCTTCTTCGACGAAA...

CDS

Download CDS FASTA

1470 bp · TkA02G116900|TK1151|CDS

ATGTTTTTAGTTGCTAATCTTCGCATTTCATTCTTTTCAAGAAACCCTAGGACTGCCATATTTGCTCTTCATACAGTGCCATCGCCTTCTTCGACGAAAATCGTCGCGGAGTACGCAAAATCAGGAAAATCTGCATGCAAAAAATGCTCCGAAAAGATTGATTCGAAATCCTTGAGATTAGGGTTAAAGAGTTGGGACCCTCGAGGATATGATAGCACTAAATGGCATCACTTCGACTGTTTCTTTTCTATGGATTCCAT...

Protein

Download Protein FASTA

489 aa · TkA02G116900|TK1151|PROTEIN

MFLVANLRISFFSRNPRTAIFALHTVPSPSSTKIVAEYAKSGKSACKKCSEKIDSKSLRLGLKSWDPRGYDSTKWHHFDCFFSMDSIPASSAETIEGFSELTGSDQDKLKEMVSEEDRLSTKREGDVDAESDKRDLKKLKTDEDEIEKEKRNERLGKIHAEYAKSGRSLCKRCTKKIEFKSLRLGLSIWDTRGFENTKWFHSECCFELHGNFLTVESIEGFSELKVSDQERLMKLIDEWDQSFNKSKEDDEANFNKFINK...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G116900`
TK1151 ID	TkA02G116900
OH-1004 ID	LXL04_016624
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	98.200
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G116900

Location Chr02:30507380-30511446 (+)

Description Similar to ZDP: Polynucleotide 3'-phosphatase ZDP

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g14890`	Nick-sensing 3'-phosphoesterase involved in a base excision repair pathway required for active DNA demethylation.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_016624 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006261 DNA-templated DNA replication Biological Process

GO:0006281 DNA repair Biological Process

GO:0006282 regulation of DNA repair Biological Process

GO:0006287 base-excision repair, gap-filling Biological Process

GO:0006289 nucleotide-excision repair Biological Process

GO:0006303 double-strand break repair via nonhomologous end joining Biological Process

GO:0006351 DNA-templated transcription Biological Process

GO:0006974 DNA damage response Biological Process

GO:0006979 response to oxidative stress Biological Process

GO:0009314 response to radiation Biological Process

GO:0032206 positive regulation of telomere maintenance Biological Process

GO:0070534 protein K63-linked ubiquitination Biological Process

KEGG gene cross-reference

ath:AT3G14890

cel:CELE_F21D5.5

hsa:11284

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.641

Rank 1 · TkA02G116900 · TK1151

Cytoplasm0.339

Rank 2 · TkA02G116900 · TK1151

Cell membrane0.056

Rank 3 · TkA02G116900 · TK1151

Endoplasmic reticulum0.051

Rank 4 · TkA02G116900 · TK1151

Mitochondrion0.036

Rank 5 · TkA02G116900 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF20586DUF678833-50 aa

PF00645zf-PARP37-112 aa

PF21362Sina_RING41-54 aa

PF23545Zn_ribbon_HMPTM42-57 aa

PF27661DRC10_N93-174 aa

PF20586DUF6788147-174 aa

PF00645zf-PARP161-236 aa

PF21362Sina_RING164-178 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G116900	`PF20586`	DUF6788	33	50	1.9	9.3
TkA02G116900	`PF00645`	zf-PARP	37	112	3.2e-33	115.0
TkA02G116900	`PF21362`	Sina_RING	41	54	0.29	12.0
TkA02G116900	`PF23545`	Zn_ribbon_HMPTM	42	57	0.069	13.4
TkA02G116900	`PF27661`	DRC10_N	93	174	0.033	15.1
TkA02G116900	`PF20586`	DUF6788	147	174	1.9	9.3
TkA02G116900	`PF00645`	zf-PARP	161	236	3.2e-33	115.0
TkA02G116900	`PF21362`	Sina_RING	164	178	0.29	12.0
TkA02G116900	`PF23545`	Zn_ribbon_HMPTM	167	178	0.069	13.4
TkA02G116900	`PF26815`	Phage_RepB	205	260	0.14	12.5
TkA02G116900	`PF08645`	PNK3P	250	266	4.3e-47	160.5
TkA02G116900	`PF08645`	PNK3P	327	487	4.3e-47	160.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q84JE8`	Arabidopsis thaliana	sp\|Q84JE8\|ZDP_ARATH Polynucleotide 3'-phosphatase ZDP	48.200%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card