LXL04_016624 | RubberDandelionOmics

Gene overview

LXL04_016624

Reference: OH-1004 Chr: Chr03 Coordinates: 129438689-129442366 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1452 bp · LXL04_016624|LXL04_016624|OH1004|cDNA

ATGTTTTTAGTTGCTAATCTTCGCATTTCATTCTTTTCAAGAAACCCTAGGACTGCCATATTTGCTCTTCATACAGTGCCATCGCCTTCTTCGACGAAAATCGTCGCGGAGTACGCAAAATCAGGAAAATCTGCATGCAAAAAATGCTCCGAAAAGATTGATTCGAAATCCTTGAGATTAGGGTTAAAGAGTTGGGACCCTCGAGGATATGATAGCACTAAATGGCATCACTTCGACTGTTTCTTTTCTATGGATTCCAT...

CDS

Download CDS FASTA

1452 bp · LXL04_016624|LXL04_016624|OH1004|CDS

ATGTTTTTAGTTGCTAATCTTCGCATTTCATTCTTTTCAAGAAACCCTAGGACTGCCATATTTGCTCTTCATACAGTGCCATCGCCTTCTTCGACGAAAATCGTCGCGGAGTACGCAAAATCAGGAAAATCTGCATGCAAAAAATGCTCCGAAAAGATTGATTCGAAATCCTTGAGATTAGGGTTAAAGAGTTGGGACCCTCGAGGATATGATAGCACTAAATGGCATCACTTCGACTGTTTCTTTTCTATGGATTCCAT...

Protein

Download Protein FASTA

483 aa · LXL04_016624|LXL04_016624|OH1004|PROTEIN

MFLVANLRISFFSRNPRTAIFALHTVPSPSSTKIVAEYAKSGKSACKKCSEKIDSKSLRLGLKSWDPRGYDSTKWHHFDCFFSMDSIPASSAETIEGFSELTGSDQDKLKEMVSEEDRLSTKREGDVDAESDKRDLKKLKTDEDEIEKEKRNERLGKIHAEYAKSGRSLCKRCTKKIEFKSLRLGLSIWDTRGFENTKWFHSECCFELHGNFLTVESIEGFSELKRSRKIDEWDQSFNKSKEDDEANFNKFINKIINVLQ...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_016624`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_016624

Location Chr03:129438689-129442366 (-)

Description Similar to ZDP: Polynucleotide 3'-phosphatase ZDP

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g14890`	Nick-sensing 3'-phosphoesterase involved in a base excision repair pathway required for active DNA demethylation.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_016624 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006261 DNA-templated DNA replication Biological Process

GO:0006281 DNA repair Biological Process

GO:0006282 regulation of DNA repair Biological Process

GO:0006287 base-excision repair, gap-filling Biological Process

GO:0006289 nucleotide-excision repair Biological Process

GO:0006303 double-strand break repair via nonhomologous end joining Biological Process

GO:0006351 DNA-templated transcription Biological Process

GO:0006974 DNA damage response Biological Process

GO:0006979 response to oxidative stress Biological Process

GO:0009314 response to radiation Biological Process

GO:0032206 positive regulation of telomere maintenance Biological Process

GO:0070534 protein K63-linked ubiquitination Biological Process

KEGG gene cross-reference

ath:AT3G14890

cel:CELE_F21D5.5

hsa:11284

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.672

Rank 1 · LXL04_016624 · OH-1004

Cytoplasm0.306

Rank 2 · LXL04_016624 · OH-1004

Cell membrane0.056

Rank 3 · LXL04_016624 · OH-1004

Endoplasmic reticulum0.054

Rank 4 · LXL04_016624 · OH-1004

Mitochondrion0.035

Rank 5 · LXL04_016624 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00645.26zf-PARP37-112 aa

PF00645.26zf-PARP161-227 aa

PF08645.18PNK3P321-481 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_016624	`PF00645.26`	zf-PARP	37	112	5e-30	104.8
LXL04_016624	`PF00645.26`	zf-PARP	161	227	5e-30	104.8
LXL04_016624	`PF08645.18`	PNK3P	321	481	4.2e-47	160.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q84JE8`	Arabidopsis thaliana	Polynucleotide 3'-phosphatase ZDP	47.159%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card