TkA02G113200 | RubberDandelionOmics

Gene overview

TkA02G113200

Reference: TK1151 Chr: Chr02 Coordinates: 29635092-29638921 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

3288 bp · TkA02G113200|TK1151|cDNA

TTGAGTTCTTCGCCTCACGGTTTGGCTACCCATCGTCATTCCCTCTCTGTCTAAAGTGAGAGGGGTTCTCTGCGCGCAGTGTAAGATTCCCCTGGATGGGTCTCGTAGGCAGCAGCATTCGTGCTTGCCTTTGCCGTGATTGTCCGTTGTTCCCTTGGTGCGCTGTCATTGACGGTGTAAATCAGTTCGTTCGATAAAACATGTTGATCTCTTTCCATATCCTATCCCCGGTTGTTGCCCTATCAAGATGTGTCCCTTCC...

CDS

Download CDS FASTA

543 bp · TkA02G113200|TK1151|CDS

ATGGCAGTCCCCGCACATGATTCCCGTGACCATGAATTTGCGATAAAATATAAAATCGCGATTCATTGGGTGGTGACATCAGACGAATGTGTTGATGATTTTGAAAAAGCGTATGCTGGTGAAGGAGTTGTGATTAATTCATCAAGTGAAACATCAGGGCTTGATATTAATGGGTTAAGTAGTAAACAAGCTGCTGTTGAAGTTATTAATTGGGTCGAAAAGACTGGAAATGGAAATAGAAAGATAAAATATAAGTTGAG...

Protein

Download Protein FASTA

180 aa · TkA02G113200|TK1151|PROTEIN

MAVPAHDSRDHEFAIKYKIAIHWVVTSDECVDDFEKAYAGEGVVINSSSETSGLDINGLSSKQAAVEVINWVEKTGNGNRKIKYKLRDWLFARQRYWGEPIPVVFLDGNDETVPIPESELPLTLPDLDDFTPTGTGDPPLSKAVSWVKTVDSFSVKQTLCHNGLVLAGKFTYLLIINKVK

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G113200`
TK1151 ID	TkA02G113200
OH-1004 ID	LXL04_016668
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	98.700
Protein coverage (%)	TK1151 86.667 / OH-1004 11.080 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G113200

Location Chr02:29635092-29638921 (-)

Description Similar to CSC1: Calcium permeable stress-gated cation channel 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g04350`	Catalyzes the specific attachment of an amino acid to its cognate tRNA in a two step reaction: the amino acid (AA) is first activated by ATP to form AA-AMP and then transferred to the acceptor end of the tRNA.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_016668 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006812 monoatomic cation transport Biological Process

GO:0006970 response to osmotic stress Biological Process

GO:0010118 stomatal movement Biological Process

GO:0045087 innate immune response Biological Process

GO:0051262 protein tetramerization Biological Process

GO:0071474 cellular hyperosmotic response Biological Process

GO:0090279 regulation of calcium ion import Biological Process

GO:0140426 pathogen-associated molecular pattern receptor signaling pathway Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0005227 calcium-activated cation channel activity Molecular Function

KEGG gene cross-reference

ath:AT1G11960

ath:AT1G62320

ath:AT3G21620

ath:AT4G04340

ath:AT4G22120

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.692

Rank 1 · TkA02G113200 · TK1151

Nucleus0.277

Rank 2 · TkA02G113200 · TK1151

Plastid0.097

Rank 3 · TkA02G113200 · TK1151

Mitochondrion0.089

Rank 4 · TkA02G113200 · TK1151

Peroxisome0.080

Rank 5 · TkA02G113200 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF13603tRNA-synt_1_21-71 aa

PF00133tRNA-synt_165-114 aa

PF13603tRNA-synt_1_287-95 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G113200	`PF13603`	tRNA-synt_1_2	1	71	3.2e-12	47.0
TkA02G113200	`PF00133`	tRNA-synt_1	65	114	4.7e-05	23.0
TkA02G113200	`PF13603`	tRNA-synt_1_2	87	95	3.2e-12	47.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9XEA0`	Arabidopsis thaliana	sp\|Q9XEA0\|SYLM_ARATH Leucine--tRNA ligase, chloroplastic/mitochondrial	67.100%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card