LXL04_016668 | RubberDandelionOmics

Gene overview

LXL04_016668

Reference: OH-1004 Chr: Chr03 Coordinates: 130403964-130416170 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

4227 bp · LXL04_016668|LXL04_016668|OH1004|cDNA

ATGGCGACGCTAGCAGATATCGGTCTGTCGGCAGCCATTAATATCATCACTGCTTTTATTTTCCTGATAGCTTTCGCTATCCTTCGACTTCAACCTTTCAACGATCGTGTATACTTTCCAAAATGGTATCTCAAGGGTTTACGATCAAGCCCTGCAACTTCCGGTGCTTTTGTAAGCAAGTTCATCAATCTGGATTATCGATCCTATTTAAAATTCCTTAATTGGATGCCGGATGCCCTAAAAATGCCCGAGCCTGAGCT...

CDS

Download CDS FASTA

4227 bp · LXL04_016668|LXL04_016668|OH1004|CDS

ATGGCGACGCTAGCAGATATCGGTCTGTCGGCAGCCATTAATATCATCACTGCTTTTATTTTCCTGATAGCTTTCGCTATCCTTCGACTTCAACCTTTCAACGATCGTGTATACTTTCCAAAATGGTATCTCAAGGGTTTACGATCAAGCCCTGCAACTTCCGGTGCTTTTGTAAGCAAGTTCATCAATCTGGATTATCGATCCTATTTAAAATTCCTTAATTGGATGCCGGATGCCCTAAAAATGCCCGAGCCTGAGCT...

Protein

Download Protein FASTA

1408 aa · LXL04_016668|LXL04_016668|OH1004|PROTEIN

MATLADIGLSAAINIITAFIFLIAFAILRLQPFNDRVYFPKWYLKGLRSSPATSGAFVSKFINLDYRSYLKFLNWMPDALKMPEPELIDHAGLDSAVYLRIYLLGSEHHVFLIGTHLTCIDTPQDHRLAIGSQIYHLNETTPFLVFQIEVSTAIIATWSHLLKIFIPILVLTWAILVPVNWTNDTLDKLKGEATYSEIDKLSISNIPLGSHRHGNHTYHHMLLRFRPYLTKGHSRLLNLYINIIVTFDDCRFWTHVVMAY...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_016668`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_016668

Location Chr03:130403964-130416170 (+)

Description Similar to CSC1: Calcium permeable stress-gated cation channel 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g22120`	Acts as an osmosensitive calcium-permeable cation channel.	OSCA/TMEM63 are an Evolutionarily Conserved Family of Mechanically Activated Ion Channels.2018 · DOI: 10.7554/elife.41844 Structure-guided mutagenesis of OSCAs reveals differential activation to mechanical stimuli.2024 · DOI: 10.7554/elife.93147
`At4g04340`	May act as a hyperosmolarity-gated nonselective cation channel permeable to Ca²⁺.	OSCA1 mediates osmotic-stress-evoked Ca2+ increases vital for osmosensing in Arabidopsis.2014 · DOI: 10.1038/nature13593 OSCA/TMEM63 are an Evolutionarily Conserved Family of Mechanically Activated Ion Channels.2018 · DOI: 10.7554/elife.41844
`At3g21620`	Acts as an osmosensitive calcium-permeable cation channel.	No verified direct reference in this release
`At1g11960`	Calcium-permeable channel that plays a key role in plant stomatal immunity.	The calcium-permeable channel OSCA1.3 regulates plant stomatal immunity.2020 · DOI: 10.1038/s41586-020-2702-1
`At1g62320`	Acts as an osmosensitive calcium-permeable cation channel.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_016668 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006812 monoatomic cation transport Biological Process

GO:0006970 response to osmotic stress Biological Process

GO:0010118 stomatal movement Biological Process

GO:0045087 innate immune response Biological Process

GO:0051262 protein tetramerization Biological Process

GO:0071474 cellular hyperosmotic response Biological Process

GO:0090279 regulation of calcium ion import Biological Process

GO:0140426 pathogen-associated molecular pattern receptor signaling pathway Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0005227 calcium-activated cation channel activity Molecular Function

KEGG gene cross-reference

ath:AT1G11960

ath:AT1G62320

ath:AT3G21620

ath:AT4G04340

ath:AT4G22120

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.384

Rank 1 · LXL04_016668 · OH-1004

Endoplasmic reticulum0.237

Rank 2 · LXL04_016668 · OH-1004

Cell membrane0.128

Rank 3 · LXL04_016668 · OH-1004

Golgi apparatus0.092

Rank 4 · LXL04_016668 · OH-1004

Cytoplasm0.074

Rank 5 · LXL04_016668 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF13967.12RSN1_TM8-115 aa

PF13967.12RSN1_TM160-273 aa

PF14703.13PHM7_cyt328-416 aa

PF02714.21RSN1_7TM427-696 aa

PF00133.29tRNA-synt_1902-1119 aa

PF09334.18tRNA-synt_1g932-1064 aa

PF13603.13tRNA-synt_1_21114-1290 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_016668	`PF13967.12`	RSN1_TM	8	115	3.6e-31	108.7
LXL04_016668	`PF13967.12`	RSN1_TM	160	273	3.6e-31	108.7
LXL04_016668	`PF14703.13`	PHM7_cyt	328	416	6.1e-29	102.2
LXL04_016668	`PF02714.21`	RSN1_7TM	427	696	7.6e-84	282.0
LXL04_016668	`PF00133.29`	tRNA-synt_1	902	1119	1e-34	120.8
LXL04_016668	`PF09334.18`	tRNA-synt_1g	932	1064	9.1e-19	68.2
LXL04_016668	`PF13603.13`	tRNA-synt_1_2	1114	1290	8.8e-59	198.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q5XEZ5`	Arabidopsis thaliana	Hyperosmolality-gated Ca2+ permeable channel 1.2	61.921%	Swiss-Prot	moderate database homology
`Q9XEA1`	Arabidopsis thaliana	Hyperosmolality-gated Ca2+ permeable channel 1.1	60.620%	Swiss-Prot	moderate database homology
`Q9LVE4`	Arabidopsis thaliana	Hyperosmolality-gated Ca2+ permeable channel 1.5	60.118%	Swiss-Prot	moderate database homology
`B5TYT3`	Arabidopsis thaliana	Hyperosmolality-gated Ca2+ permeable channel 1.3	59.064%	Swiss-Prot	moderate database homology
`F4HYR3`	Arabidopsis thaliana	Hyperosmolality-gated Ca2+ permeable channel 1.4	59.722%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card