TkA02G112170 | RubberDandelionOmics

Gene overview

TkA02G112170

Reference: TK1151 Chr: Chr02 Coordinates: 29351936-29355057 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2993 bp · TkA02G112170|TK1151|cDNA

CTAAACGAAAACAATGTTACCATTTTAAAAGTTCATAATAGCTGGCAACCTGGAGTAGCAGATCATAAGGACTTGTTGTATACAAAACTGAAACAATAAGAACTTATTTAACAAAAAAATACAATAGGAACGAAATGTGGATAAACCTGAAGTAACATTACCCGAATCGTTTTCGTAATTTTAAAACTACCTCATTTTTTGGTAATTAAGTTTTTCAAATACAACCATAGGTCAAAAACTGAACATTTCATGCCTGATGA...

CDS

Download CDS FASTA

1206 bp · TkA02G112170|TK1151|CDS

ATGCCTGATGAACAAAAGTTCGGTTTATGGCAGCTTCCGGATTTTGGTTCGAAAAATAAGATGATTTCTCGTCCGATCGTAGCTTGCAATACCAAACTTCCCAAAACCTATCTGATCTTCCTTCAACTAAACTTGTATCACTCAACTGTTTCACTCAGTTCTTCTATAAAACTCGATCCCCTCGACTTACGCAATTACAAAGACTGGTTAAGTCCGACTGAAGTCATCAAGATTTTCGAAACCCTAAAAAATCCCAATTC...

Protein

Download Protein FASTA

401 aa · TkA02G112170|TK1151|PROTEIN

MPDEQKFGLWQLPDFGSKNKMISRPIVACNTKLPKTYLIFLQLNLYHSTVSLSSSIKLDPLDLRNYKDWLSPTEVIKIFETLKNPNSTLTVLNQLSKRKDYKPNEALYTSVINNLSEAKNFDGIEEVMKRIKVEKSCRLSDGFFYNVIRIYGLRAGRINRAIETLFDMPNYSSWPTPKTFNFVLNLLVNTKQFDVIHEVYMGAGKLGVEVDACCLNIMIKGLCKNGKINDALQVFDEFPKQNCKPNVRTFSTLMHGLCSL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G112170`
TK1151 ID	TkA02G112170
OH-1004 ID	LXL04_016679
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.500
Protein coverage (%)	TK1151 95.012 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G112170

Location Chr02:29351936-29355057 (-)

Description Similar to At3g14580: Pentatricopeptide repeat-containing protein At3g14580, mitochondrial

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g14580`	Pentatricopeptide repeat-containing protein At3g14580, mitochondrial.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_016679 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009793 embryo development ending in seed dormancy Biological Process

GO:0005739 mitochondrion Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0003723 RNA binding Molecular Function

GO:0003729 mRNA binding Molecular Function

KEGG gene cross-reference

ath:AT3G14580

ath:AT4G20090

ath:AT5G46100

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Mitochondrion0.865

Rank 1 · TkA02G112170 · TK1151

Plastid0.067

Rank 2 · TkA02G112170 · TK1151

Nucleus0.051

Rank 3 · TkA02G112170 · TK1151

Cytoplasm0.033

Rank 4 · TkA02G112170 · TK1151

Cell membrane0.011

Rank 5 · TkA02G112170 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00637Clathrin64-130 aa

PF23276TPR_2476-131 aa

PF29978ATP18_TPR88-122 aa

PF29070MSC6_N90-129 aa

PF30136MSC6_C90-107 aa

PF17177PPR_long91-134 aa

PF13812PPR_397-134 aa

PF12854PPR_1100-113 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G112170	`PF00637`	Clathrin	64	130	0.012	16.1
TkA02G112170	`PF23276`	TPR_24	76	131	4.3e-14	53.3
TkA02G112170	`PF29978`	ATP18_TPR	88	122	0.15	12.7
TkA02G112170	`PF29070`	MSC6_N	90	129	8.7e-16	58.7
TkA02G112170	`PF30136`	MSC6_C	90	107	0.035	14.2
TkA02G112170	`PF17177`	PPR_long	91	134	1.3e-14	54.9
TkA02G112170	`PF13812`	PPR_3	97	134	1.3e-18	67.5
TkA02G112170	`PF12854`	PPR_1	100	113	1.9e-40	137.0
TkA02G112170	`PF13041`	PPR_2	103	129	7.3e-41	138.8
TkA02G112170	`PF25569`	TPR_ZFYVE26	105	151	0.012	16.6
TkA02G112170	`PF12921`	ATP13	106	131	0.085	13.5
TkA02G112170	`PF01535`	PPR	108	133	2e-32	109.8
TkA02G112170	`PF10037`	MRP-S27	110	193	3.3e-07	30.3
TkA02G112170	`PF23276`	TPR_24	136	237	4.3e-14	53.3
TkA02G112170	`PF13041`	PPR_2	153	188	7.3e-41	138.8
TkA02G112170	`PF12854`	PPR_1	154	168	1.9e-40	137.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LUD6`	Arabidopsis thaliana	sp\|Q9LUD6\|PP230_ARATH Pentatricopeptide repeat-containing protein At3g14580, mitochondrial	58.000%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card