TkA02G106050 | RubberDandelionOmics

Gene overview

TkA02G106050

Reference: TK1151 Chr: Chr02 Coordinates: 27782693-27783361 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

510 bp · TkA02G106050|TK1151|cDNA

ATGGGAGGAAAAGCGACAGATGGGTGTGGTGAGTTCATGGCGTCCGGCGAGGAAGGTACGCTTGAAGCTCTCACTTGCGCAGTCTGTAACTGTCATAGAAACTTCCACCGGAAAGAGATGGAAGGTGACAGCCCCCACCATCACCACCACCGGCACCACCCCATTCCCACGACCTCCTATGACTACATTAATTACCACGGTACCGCCCCTCCACATCTGAAACGACTCGATCTCGGAAACGGAAGAAACAGGTTCAGGAC...

CDS

Download CDS FASTA

510 bp · TkA02G106050|TK1151|CDS

ATGGGAGGAAAAGCGACAGATGGGTGTGGTGAGTTCATGGCGTCCGGCGAGGAAGGTACGCTTGAAGCTCTCACTTGCGCAGTCTGTAACTGTCATAGAAACTTCCACCGGAAAGAGATGGAAGGTGACAGCCCCCACCATCACCACCACCGGCACCACCCCATTCCCACGACCTCCTATGACTACATTAATTACCACGGTACCGCCCCTCCACATCTGAAACGACTCGATCTCGGAAACGGAAGAAACAGGTTCAGGAC...

Protein

Download Protein FASTA

169 aa · TkA02G106050|TK1151|PROTEIN

MGGKATDGCGEFMASGEEGTLEALTCAVCNCHRNFHRKEMEGDSPHHHHHRHHPIPTTSYDYINYHGTAPPHLKRLDLGNGRNRFRTKFTQEQKEKMVNFAEKVGWKIQRQEESVVQHFCQEIGIKRRVLKVWMHNNKQNLAKNNNSISINGPQPQTQPQPQPQPEDPS

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G106050`
TK1151 ID	TkA02G106050
OH-1004 ID	LXL04_016742
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	73.800
Protein coverage (%)	TK1151 90.533 / OH-1004 62.805 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G106050

Location Chr02:27782693-27783361 (+)

Description Similar to ZHD3: Zinc-finger homeodomain protein 3

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g14440`	Putative transcription factor.	No verified direct reference in this release
`At2g02540`	Putative transcription factor.	No verified direct reference in this release
`At4g24660`	Essential protein.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`UniProt: A2Z259`	Putative transcription factor.	No verified direct reference in this release
`Os09g0466400`	Putative transcription factor.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_016742 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0019760 glucosinolate metabolic process Biological Process

GO:0048574 long-day photoperiodism, flowering Biological Process

GO:0050793 regulation of developmental process Biological Process

GO:0005634 nucleus Cellular Component

GO:0000976 transcription cis-regulatory region binding Molecular Function

GO:0003677 DNA binding Molecular Function

GO:0003700 DNA-binding transcription factor activity Molecular Function

GO:0008270 zinc ion binding Molecular Function

GO:0042803 protein homodimerization activity Molecular Function

KEGG gene cross-reference

ath:AT1G14440

ath:AT2G02540

dosa:Os08g0479400

dosa:Os09g0466400

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.970

Rank 1 · TkA02G106050 · TK1151

Cytoplasm0.089

Rank 2 · TkA02G106050 · TK1151

Cell membrane0.023

Rank 3 · TkA02G106050 · TK1151

Endoplasmic reticulum0.012

Rank 4 · TkA02G106050 · TK1151

Mitochondrion0.010

Rank 5 · TkA02G106050 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF04770ZF-HD_dimer1-40 aa

PF24852DUF772610-42 aa

PF10430Ig_Tie2_181-122 aa

PF00046Homeodomain84-139 aa

PF24852DUF772688-106 aa

PF29105DUF850490-154 aa

PF24852DUF7726108-141 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G106050	`PF04770`	ZF-HD_dimer	1	40	1.9e-20	73.6
TkA02G106050	`PF24852`	DUF7726	10	42	0.083	13.7
TkA02G106050	`PF10430`	Ig_Tie2_1	81	122	0.16	13.1
TkA02G106050	`PF00046`	Homeodomain	84	139	0.61	10.7
TkA02G106050	`PF24852`	DUF7726	88	106	0.083	13.7
TkA02G106050	`PF29105`	DUF8504	90	154	0.14	13.0
TkA02G106050	`PF24852`	DUF7726	108	141	0.083	13.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9M9S0`	Arabidopsis thaliana	sp\|Q9M9S0\|ZHD4_ARATH Zinc-finger homeodomain protein 4	52.500%	Swiss-Prot	High
`O64722`	Arabidopsis thaliana	sp\|O64722\|ZHD3_ARATH Zinc-finger homeodomain protein 3	51.800%	Swiss-Prot	High
`Q9SB61`	Arabidopsis thaliana	sp\|Q9SB61\|ZHD2_ARATH Zinc-finger homeodomain protein 2	47.200%	Swiss-Prot	Medium
`A2Z259`	Oryza sativa subsp. indica	sp\|A2Z259\|ZHD1_ORYSI Zinc-finger homeodomain protein 1	42.100%	Swiss-Prot	Medium
`Q6YXH5`	Oryza sativa subsp. japonica	sp\|Q6YXH5\|ZHD1_ORYSJ Zinc-finger homeodomain protein 1	42.100%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card