TkA02G100220 | RubberDandelionOmics

Gene overview

TkA02G100220

Reference: TK1151 Chr: Chr02 Coordinates: 26190522-26196995 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2480 bp · TkA02G100220|TK1151|cDNA

AATAGGGTTAATTTGGTATTTGCTATTTTTGGCTAACGGAATAGGGAAAGAAAATAGTCACGCCGTCCGTCTCTTCATTCTGGTCTGTGTATGTCAATTTCGAACTAGTCCCACACACCATCTCGTCGTCGCCACTCGCCACTCCCGGAATCGATTTCGACGGCCCTCTGCTCCTCCAGTTCCCGTCGACGACGTCGACCCTACTCGAGTGCTCGGACAGTCGCTCGCAGTCGCAGCTCGCCTCGCCCTCACTCCTCACT...

CDS

Download CDS FASTA

1923 bp · TkA02G100220|TK1151|CDS

ATGTATTTAATGCTGAGTTCAACCAGTTTCCTTCACAACAGTCCCAGCCATCAAGTTGGTGTTACTTCAGCCATCTGTTCCAATAGAACTACATTCAGGAGCTTTAACAGCACTTCTTTTTCTTCATGCTCTTCTTCTTCTTCTTCATGTTCAATGATCAACCAACAAATTGGTCGCAACATGACTTGTCGAGCATCCATGGAAACTGATGTTTCAATTAAGAAGGAGCAAATGCCACCAGCTCATGGACTATCTGAAAA...

Protein

Download Protein FASTA

640 aa · TkA02G100220|TK1151|PROTEIN

MYLMLSSTSFLHNSPSHQVGVTSAICSNRTTFRSFNSTSFSSCSSSSSSCSMINQQIGRNMTCRASMETDVSIKKEQMPPAHGLSEKIVGVLGGGQLGRMLCQAASQMSIKVNILDPLVNCPASTICHHHMVGSFDNSITVEEFAKRCDILTVEIEHVDADTLEKLEKQGVDCQPKASTIRIIQDKFLQKVHFSRHGIPLPKFMQIDDEESAKKAGLEFGYPLMVKSRRLAYDGRGNAVAKSEQELTSAINALGGFGHGL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G100220`
TK1151 ID	TkA02G100220
OH-1004 ID	LXL04_016810
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	97.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA02G100220`
Location	Chr02:26190522-26196995 (+)
Description	Similar to PURKE: Phosphoribosylaminoimidazole carboxylase, chloroplastic (Fragment)
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_016810` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0006144 purine nucleobase metabolic process Biological Process GO:0006189 'de novo' IMP biosynthetic process Biological Process GO:0009113 purine nucleobase biosynthetic process Biological Process GO:0005737 cytoplasm Cellular Component GO:0005829 cytosol Cellular Component GO:0009507 chloroplast Cellular Component GO:0004638 phosphoribosylaminoimidazole carboxylase activity Molecular Function GO:0005524 ATP binding Molecular Function GO:0046872 metal ion binding Molecular Function
KEGG gene cross-reference	cgr:2890129 sce:YOR128C spo:2538734 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.906

Rank 1 · TkA02G100220 · TK1151

Mitochondrion0.141

Rank 2 · TkA02G100220 · TK1151

Cytoplasm0.029

Rank 3 · TkA02G100220 · TK1151

Nucleus0.019

Rank 4 · TkA02G100220 · TK1151

Peroxisome0.012

Rank 5 · TkA02G100220 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF028262-Hacid_dh_C74-155 aa

PF22660RS_preATP-grasp-like88-184 aa

PF07478Dala_Dala_lig_C134-155 aa

PF08443RimK184-253 aa

PF02655ATP-grasp_3184-355 aa

PF01071GARS_A186-252 aa

PF02786CPSase_L_D2190-355 aa

PF02222ATP-grasp192-370 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G100220	`PF02826`	2-Hacid_dh_C	74	155	0.0002	21.5
TkA02G100220	`PF22660`	RS_preATP-grasp-like	88	184	3.9e-31	108.0
TkA02G100220	`PF07478`	Dala_Dala_lig_C	134	155	2.6e-10	40.9
TkA02G100220	`PF08443`	RimK	184	253	0.097	13.0
TkA02G100220	`PF02655`	ATP-grasp_3	184	355	0.15	12.8
TkA02G100220	`PF01071`	GARS_A	186	252	0.0062	17.1
TkA02G100220	`PF02786`	CPSase_L_D2	190	355	5.7e-06	26.7
TkA02G100220	`PF02222`	ATP-grasp	192	370	2.5e-62	210.4
TkA02G100220	`PF07478`	Dala_Dala_lig_C	194	354	2.6e-10	40.9
TkA02G100220	`PF00731`	AIRC	319	344	2.2e-66	222.7
TkA02G100220	`PF17769`	PurK_C	392	453	6.5e-17	61.7
TkA02G100220	`PF00731`	AIRC	474	619	2.2e-66	222.7
TkA02G100220	`PF13685`	Fe-ADH_2	474	571	0.0079	16.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card