TkA02G094600 | RubberDandelionOmics

Gene overview

TkA02G094600

Reference: TK1151 Chr: Chr02 Coordinates: 24703243-24705598 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1132 bp · TkA02G094600|TK1151|cDNA

AGTAAATCATAATGTCTTAGGTGAGTAAAAAACATTGATAAAATCTCACCCAAATCGTTTTGGCGCACAAAATCTCACCCAAATCGATAAAAAGCACACAAATACCACCACCAACTTCCAACCACCAATTCTTCCGGTTCCTATGGCGTTATCCACTCTCTCAGCCGCCGTCACCACCACCACCACTCCACACCAGCTCCCTAAACTCTTCCACTCTCACTCCTCTCCCTCCACCATAACATTTCCAGCCAAACTCACCA...

CDS

Download CDS FASTA

726 bp · TkA02G094600|TK1151|CDS

ATGGCGTTATCCACTCTCTCAGCCGCCGTCACCACCACCACCACTCCACACCAGCTCCCTAAACTCTTCCACTCTCACTCCTCTCCCTCCACCATAACATTTCCAGCCAAACTCACCACCTCTCACCACCACTTTTCCGTAACCCCCATCTCAAAATGGAGGACCAATGTTTCTTTCTTAACTTCTTTCCTGAACAAACCCAAAGATGCGACACCCATTAAAGAAGAGCTTTTTGAAGCAATTGCTCCCCTTGATCGCGG...

Protein

Download Protein FASTA

241 aa · TkA02G094600|TK1151|PROTEIN

MALSTLSAAVTTTTTPHQLPKLFHSHSSPSTITFPAKLTTSHHHFSVTPISKWRTNVSFLTSFLNKPKDATPIKEELFEAIAPLDRGSEASDEDQEIIEQIVRKLEAANPTKEPLKSPLLDGKWELIYTTSQSILQTKRPKFLRSRVNYQAINVDTLRAQNMESFPTFNQVTADLTPVSTKKVAVQFDYFKIFGLVPVKAPDTARGSLEITYLDEELRVSRGDKGNLFILKMIDPSYRIPT

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G094600`
TK1151 ID	TkA02G094600
OH-1004 ID	LXL04_016893
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	98.300
Protein coverage (%)	TK1151 100.000 / OH-1004 82.253 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G094600

Location Chr02:24703243-24705598 (+)

Description Similar to PAP4: Probable plastid-lipid-associated protein 4, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g26070`	Probable plastid-lipid-associated protein 4, chloroplastic.	No verified direct reference in this release
`At3g26080`	Probable plastid-lipid-associated protein 5, chloroplastic.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os04g0422000`	Essential for plastoquinone-9 (PQ-9) biosynthesis through its interaction with the solanesyl diphosphate synthase SPS2.	Conserved Function of Fibrillin5 in the Plastoquinone-9 Biosynthetic Pathway in Arabidopsis and Rice.2017 · DOI: 10.3389/fpls.2017.01197

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_016893 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0010117 photoprotection Biological Process

GO:0010236 plastoquinone biosynthetic process Biological Process

GO:0005829 cytosol Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009534 chloroplast thylakoid Cellular Component

GO:0009535 chloroplast thylakoid membrane Cellular Component

GO:0009536 plastid Cellular Component

GO:0009579 thylakoid Cellular Component

GO:0009941 chloroplast envelope Cellular Component

GO:0010287 plastoglobule Cellular Component

KEGG gene cross-reference

ath:AT3G26070

ath:AT3G26080

ath:AT5G19940

dosa:Os04g0422000

osa:4335835

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.990

Rank 1 · TkA02G094600 · TK1151

Mitochondrion0.020

Rank 2 · TkA02G094600 · TK1151

Cytoplasm0.015

Rank 3 · TkA02G094600 · TK1151

Nucleus0.013

Rank 4 · TkA02G094600 · TK1151

Cell membrane0.011

Rank 5 · TkA02G094600 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF04755PAP_fibrillin73-231 aa

PF08401ArdcN92-164 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G094600	`PF04755`	PAP_fibrillin	73	231	2.8e-41	142.4
TkA02G094600	`PF08401`	ArdcN	92	164	0.052	14.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LU85`	Arabidopsis thaliana	sp\|Q9LU85\|PAP4_ARATH Probable plastid-lipid-associated protein 4, chloroplastic	64.500%	Swiss-Prot	High
`Q6DBN2`	Arabidopsis thaliana	sp\|Q6DBN2\|PAP5_ARATH Probable plastid-lipid-associated protein 5, chloroplastic	65.700%	Swiss-Prot	Medium
`Q0JD85`	Oryza sativa subsp. japonica	sp\|Q0JD85\|PAP7_ORYSJ Fibrillin protein 5 homolog	33.900%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card