TkA02G081020 | RubberDandelionOmics

Gene overview

TkA02G081020

Reference: TK1151 Chr: Chr02 Coordinates: 21043850-21045808 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1062 bp · TkA02G081020|TK1151|cDNA

TAAATATCTCTCCTTTCTGTTGAACAATGTAGCAGGCACCTTGTTTTATTTTACCAAATAACTAACGTCTCTTTATAAGAAACCCAGTCGTTGTGCAAAATCAGGGATGCCGGCGGCGTTGAACGCTGTAATGAACGGCGGATTAACAGGCGGAGGTGCCACCGCGGCCCAAAAAACGGTGCTGATAACAGGTGTTAGCAGAGGTCTTGGCAAAGCCCTAGCAGTAGAAATCGCGAAGAGAGGCCATTCCGTTATCGGCT...

CDS

Download CDS FASTA

768 bp · TkA02G081020|TK1151|CDS

ATGCCGGCGGCGTTGAACGCTGTAATGAACGGCGGATTAACAGGCGGAGGTGCCACCGCGGCCCAAAAAACGGTGCTGATAACAGGTGTTAGCAGAGGTCTTGGCAAAGCCCTAGCAGTAGAAATCGCGAAGAGAGGCCATTCCGTTATCGGCTGCTCTCGCTCTCAAGAGAAGCTCGATTCTCTCCAGTCGGAGCTCTGTTCTGGACCTTCTTCTTCTTCCTCTTCCTCCGAAAAACACCTCTTCTTCAACGCCGACGT...

Protein

Download Protein FASTA

255 aa · TkA02G081020|TK1151|PROTEIN

MPAALNAVMNGGLTGGGATAAQKTVLITGVSRGLGKALAVEIAKRGHSVIGCSRSQEKLDSLQSELCSGPSSSSSSSEKHLFFNADVCSNSSVQELARAVMEKKGVPDIIVNNAGTINKNNRLWEVPEEEFNAVIDTNLKGVANILRHFIPLMIEKKQGVLVNMSSGWGRSAAAQVAPYCASKWAVEGLTKSVAKELPAGMAIVALNPGVINTEMLQSCFGTSSSLYQAPDSWAPKAADMILNLTVADNGASLSV

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G081020`
TK1151 ID	TkA02G081020
OH-1004 ID	LXL04_021372
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	97.000
Protein coverage (%)	TK1151 26.275 / OH-1004 39.181 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G081020

Location Chr02:21043850-21045808 (+)

Description Similar to At1g10310: NADPH-dependent pterin aldehyde reductase

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g10310`	NADPH-dependent pterin aldehyde reductase involved in pterin aldehyde salvage during folate turnover.	Folate salvage in plants: pterin aldehyde reduction is mediated by multiple non-specific aldehyde reductases.2007 · DOI: 10.1111/j.1365-313x.2007.03143.x

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_021372 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006760 folic acid-containing compound metabolic process Biological Process

GO:0030497 fatty acid elongation Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005829 cytosol Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0004316 3-oxoacyl-[acyl-carrier-protein] reductase (NADPH) activity Molecular Function

GO:0016616 oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor Molecular Function

GO:0050661 NADP binding Molecular Function

GO:0051287 NAD binding Molecular Function

KEGG gene cross-reference

ath:AT1G10310

sam:MW1114

sep:SE_0906

ser:SERP0797

tma:TM1724

tmi:THEMA_05620

tmm:Tmari_1732

tmw:THMA_1766

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Mitochondrion0.468

Rank 1 · TkA02G081020 · TK1151

Cytoplasm0.332

Rank 2 · TkA02G081020 · TK1151

Nucleus0.178

Rank 3 · TkA02G081020 · TK1151

Peroxisome0.147

Rank 4 · TkA02G081020 · TK1151

Plastid0.082

Rank 5 · TkA02G081020 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00257Dehydrin15-78 aa

PF00106adh_short23-218 aa

PF08659KR24-196 aa

PF04321RmlD_sub_bind24-63 aa

PF01370Epimerase25-206 aa

PF16363GDP_Man_Dehyd26-152 aa

PF13561adh_short_C229-229 aa

PF03807F420_oxidored34-72 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G081020	`PF00257`	Dehydrin	15	78	0.26	12.4
TkA02G081020	`PF00106`	adh_short	23	218	1.9e-46	158.8
TkA02G081020	`PF08659`	KR	24	196	1.2e-07	32.5
TkA02G081020	`PF04321`	RmlD_sub_bind	24	63	0.13	12.0
TkA02G081020	`PF01370`	Epimerase	25	206	1e-07	32.3
TkA02G081020	`PF16363`	GDP_Man_Dehyd	26	152	0.034	14.3
TkA02G081020	`PF13561`	adh_short_C2	29	229	6.7e-33	114.9
TkA02G081020	`PF03807`	F420_oxidored	34	72	0.0015	19.8
TkA02G081020	`PF03446`	NAD_binding_2	34	99	0.026	15.3
TkA02G081020	`PF00213`	OSCP	49	127	0.041	14.7
TkA02G081020	`PF03807`	F420_oxidored	86	115	0.0015	19.8
TkA02G081020	`PF10491`	Nrf1_DNA-bind	113	176	0.23	11.9
TkA02G081020	`PF00213`	OSCP	126	159	0.041	14.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SY73`	Arabidopsis thaliana	sp\|Q9SY73\|PTALR_ARATH NADPH-dependent pterin aldehyde reductase	71.500%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card