LXL04_021372 | RubberDandelionOmics

Gene overview

LXL04_021372

Reference: OH-1004 Chr: Chr04 Coordinates: 128368347-128368949 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

516 bp · LXL04_021372|LXL04_021372|OH1004|cDNA

ATGCGGAAATCTCGGAGCTTTTTCAAGTTCATTCCCATGGTTTCTAGGGCTGCGTTTGTGATATCGGAGACGTATACTGCTATATACTCTAAATCCAGACATCCTTGTGCTATTGCTAATCCCCTTTGTGAAACAACACCCTCTTCGTCTTCCATTTCCTGTTCATCTGCTCCTCGCTCGATTCGAAGCCGTTTCAGCAATTTCATCAAATTTGGTTGGATGTTTACGGAATTATCGTTCTCTGTTTCTTTTCAGTTCTC...

CDS

Download CDS FASTA

516 bp · LXL04_021372|LXL04_021372|OH1004|CDS

ATGCGGAAATCTCGGAGCTTTTTCAAGTTCATTCCCATGGTTTCTAGGGCTGCGTTTGTGATATCGGAGACGTATACTGCTATATACTCTAAATCCAGACATCCTTGTGCTATTGCTAATCCCCTTTGTGAAACAACACCCTCTTCGTCTTCCATTTCCTGTTCATCTGCTCCTCGCTCGATTCGAAGCCGTTTCAGCAATTTCATCAAATTTGGTTGGATGTTTACGGAATTATCGTTCTCTGTTTCTTTTCAGTTCTC...

Protein

Download Protein FASTA

171 aa · LXL04_021372|LXL04_021372|OH1004|PROTEIN

MRKSRSFFKFIPMVSRAAFVISETYTAIYSKSRHPCAIANPLCETTPSSSSISCSSAPRSIRSRFSNFIKFGWMFTELSFSVSFQFSNSSVQELTRAVMEKKGVPDIIVNNAGTINKNNRLWEVPEEEFNAVIDTNLKGVANILCHFIPLMIENFHSPVSNHVSCLQFHQI

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_021372`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_021372

Location Chr04:128368347-128368949 (+)

Description Similar to At1g10310: NADPH-dependent pterin aldehyde reductase

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g10310`	NADPH-dependent pterin aldehyde reductase involved in pterin aldehyde salvage during folate turnover.	Folate salvage in plants: pterin aldehyde reduction is mediated by multiple non-specific aldehyde reductases.2007 · DOI: 10.1111/j.1365-313x.2007.03143.x

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_021372 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006760 folic acid-containing compound metabolic process Biological Process

GO:0030497 fatty acid elongation Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005829 cytosol Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0004316 3-oxoacyl-[acyl-carrier-protein] reductase (NADPH) activity Molecular Function

GO:0016616 oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor Molecular Function

GO:0050661 NADP binding Molecular Function

GO:0051287 NAD binding Molecular Function

KEGG gene cross-reference

ath:AT1G10310

sam:MW1114

sep:SE_0906

ser:SERP0797

tma:TM1724

tmi:THEMA_05620

tmm:Tmari_1732

tmw:THMA_1766

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Mitochondrion0.407

Rank 1 · LXL04_021372 · OH-1004

Cytoplasm0.308

Rank 2 · LXL04_021372 · OH-1004

Nucleus0.194

Rank 3 · LXL04_021372 · OH-1004

Plastid0.076

Rank 4 · LXL04_021372 · OH-1004

Peroxisome0.058

Rank 5 · LXL04_021372 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00106.32adh_short87-154 aa

PF13561.13adh_short_C288-154 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_021372	`PF00106.32`	adh_short	87	154	3.5e-09	37.1
LXL04_021372	`PF13561.13`	adh_short_C2	88	154	1.7e-09	38.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SY73`	Arabidopsis thaliana	NADPH-dependent pterin aldehyde reductase	69.697%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card