TkA02G074590 | RubberDandelionOmics

Gene overview

TkA02G074590

Reference: TK1151 Chr: Chr02 Coordinates: 19337913-19339118 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1026 bp · TkA02G074590|TK1151|cDNA

ATGGCGCCATCAAAATGGCGAGGAGCCCTCACCACGGCTTTTCAATTCTTCATATGTTTCGGCAGTGCACTCGCTAGCATAACTAACTTTGCCGCCAGCTACTCAACAACCAACTTTGGCTGGCAGGTCGCGCTGGGATGCGGGAGTCTCCCAGCCACCATCTTAACAGTCGGGGCTATATTCATCCCCGACACCCCGTCCAGCTTGATCCAACGCGACAAGGTGGACGAGGCGTTGACCACACTGTCTAAAGTGCGGTC...

CDS

Download CDS FASTA

1026 bp · TkA02G074590|TK1151|CDS

ATGGCGCCATCAAAATGGCGAGGAGCCCTCACCACGGCTTTTCAATTCTTCATATGTTTCGGCAGTGCACTCGCTAGCATAACTAACTTTGCCGCCAGCTACTCAACAACCAACTTTGGCTGGCAGGTCGCGCTGGGATGCGGGAGTCTCCCAGCCACCATCTTAACAGTCGGGGCTATATTCATCCCCGACACCCCGTCCAGCTTGATCCAACGCGACAAGGTGGACGAGGCGTTGACCACACTGTCTAAAGTGCGGTC...

Protein

Download Protein FASTA

341 aa · TkA02G074590|TK1151|PROTEIN

MAPSKWRGALTTAFQFFICFGSALASITNFAASYSTTNFGWQVALGCGSLPATILTVGAIFIPDTPSSLIQRDKVDEALTTLSKVRSTKAAAEAEFKDLVNSTEAARLNTQNPYLKILELRYRPQLMLTVAIAGFQQLTGVGMVAFYAPVVMRTIGMGTEEALFAAVVIGIVNLVSVLMSTCMVDKIGRRFLFLGGGVQIIFSQVFIACTLAIQSQTMAEDFPKNYGVVVLVLMCLISSAFGWSWGPLTWLVPSEILPIE...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G074590`
TK1151 ID	TkA02G074590
OH-1004 ID	LXL04_017110
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	99.400
Protein coverage (%)	TK1151 100.000 / OH-1004 69.168 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G074590

Location Chr02:19337913-19339118 (-)

Description Similar to STP5: Sugar transport protein 5

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g34580`	Mediates an active uptake of hexoses, probably by sugar/hydrogen symport.	No verified direct reference in this release
`At4g21480`	Mediates an active uptake of hexoses, probably by sugar/hydrogen symport.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os01g0567600`	Mediates active uptake of hexoses by sugar:proton symport.	No verified direct reference in this release
`Os07g0106200`	Mediates active uptake of hexoses by sugar:proton symport.	Characterization and expression of monosaccharide transporters (osMSTs) in rice.2000 · DOI: 10.1093/pcp/pcd016

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_017110 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0016020 membrane Cellular Component

GO:0015145 monosaccharide transmembrane transporter activity Molecular Function

GO:0015293 symporter activity Molecular Function

KEGG gene cross-reference

ath:AT1G34580

dosa:Os01g0567500

dosa:Os04g0452700

dosa:Os07g0106200

osa:4326342

osa:4336012

rcu:8289638

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.758

Rank 1 · TkA02G074590 · TK1151

Cytoplasm0.102

Rank 2 · TkA02G074590 · TK1151

Endoplasmic reticulum0.073

Rank 3 · TkA02G074590 · TK1151

Mitochondrion0.045

Rank 4 · TkA02G074590 · TK1151

Lysosome / Vacuole0.045

Rank 5 · TkA02G074590 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00083Sugar_tr1-329 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G074590	`PF00083`	Sugar_tr	1	329	1.4e-69	235.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q93Y91`	Arabidopsis thaliana	sp\|Q93Y91\|STP5_ARATH Sugar transport protein 5	46.500%	Swiss-Prot	Medium
`O65413`	Arabidopsis thaliana	sp\|O65413\|STP12_ARATH Sugar transport protein 12	43.900%	Swiss-Prot	Medium
`Q94EC3`	Oryza sativa subsp. japonica	sp\|Q94EC3\|MST7_ORYSJ Sugar transport protein MST7	45.500%	Swiss-Prot	Medium
`Q7EZD7`	Oryza sativa subsp. japonica	sp\|Q7EZD7\|MST3_ORYSJ Sugar transport protein MST3	43.000%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card