LXL04_017110 | RubberDandelionOmics

Gene overview

LXL04_017110

Reference: OH-1004 Chr: Chr03 Coordinates: 141322396-141324959 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1482 bp · LXL04_017110|LXL04_017110|OH1004|cDNA

ATGGAAGAAAACGAGGAAATCGAAAAAACTCCATTGACGAACACCGTCGTCTTCATCTGCATAATTGCAGGTTCTGCTGGTTTAATGTATGGATACGACACTGCCGTTTCAGGAGGAGTAATGATGATGAAGCCCTTTCTGAAAGCATTCTTCCCGGCGATCCTGGCGAAGATGGTGGACACGAAACAAGACCAGTACTGTAGGTTCAATAGCCATAGATTAACTGCGTTTATCTCGTCGATGTTCATAGCTGGTTTAGC...

CDS

Download CDS FASTA

1482 bp · LXL04_017110|LXL04_017110|OH1004|CDS

ATGGAAGAAAACGAGGAAATCGAAAAAACTCCATTGACGAACACCGTCGTCTTCATCTGCATAATTGCAGGTTCTGCTGGTTTAATGTATGGATACGACACTGCCGTTTCAGGAGGAGTAATGATGATGAAGCCCTTTCTGAAAGCATTCTTCCCGGCGATCCTGGCGAAGATGGTGGACACGAAACAAGACCAGTACTGTAGGTTCAATAGCCATAGATTAACTGCGTTTATCTCGTCGATGTTCATAGCTGGTTTAGC...

Protein

Download Protein FASTA

493 aa · LXL04_017110|LXL04_017110|OH1004|PROTEIN

MEENEEIEKTPLTNTVVFICIIAGSAGLMYGYDTAVSGGVMMMKPFLKAFFPAILAKMVDTKQDQYCRFNSHRLTAFISSMFIAGLASSLLAGRVTCLIGRKFSLITSGILFLTGNGLAVFAQNVAMLIAGRLFVGFGIGFANQAAPVYITEMAPSKWRGALTTAFQFFICFGSALASITNFAASYSTTDFGWQIALGCGSLPATILTVGAIFIPDTPSSLIQRDKVDEALTTLSKVRSTKAAAEAEFKDLVNSTEAARL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_017110`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_017110

Location Chr03:141322396-141324959 (+)

Description Similar to STP5: Sugar transport protein 5

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g34580`	Mediates an active uptake of hexoses, probably by sugar/hydrogen symport.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os07g0106200`	Mediates active uptake of hexoses by sugar:proton symport.	Characterization and expression of monosaccharide transporters (osMSTs) in rice.2000 · DOI: 10.1093/pcp/pcd016
`Os04g0452700`	Mediates active uptake of hexoses by sugar:proton symport.	No verified direct reference in this release
`Os01g0567500`	Mediates active uptake of hexoses by sugar:proton symport (By similarity).	Effects of chilling on male gametophyte development in rice.2006 · DOI: 10.1016/j.cellbi.2006.03.004

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_017110 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0016020 membrane Cellular Component

GO:0015145 monosaccharide transmembrane transporter activity Molecular Function

GO:0015293 symporter activity Molecular Function

KEGG gene cross-reference

ath:AT1G34580

dosa:Os01g0567500

dosa:Os04g0452700

dosa:Os07g0106200

osa:4326342

osa:4336012

rcu:8289638

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.794

Rank 1 · LXL04_017110 · OH-1004

Cytoplasm0.106

Rank 2 · LXL04_017110 · OH-1004

Endoplasmic reticulum0.062

Rank 3 · LXL04_017110 · OH-1004

Mitochondrion0.045

Rank 4 · LXL04_017110 · OH-1004

Lysosome / Vacuole0.037

Rank 5 · LXL04_017110 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00083.31Sugar_tr20-481 aa

PF07690.22MFS_174-430 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_017110	`PF00083.31`	Sugar_tr	20	481	1.8e-98	331.1
LXL04_017110	`PF07690.22`	MFS_1	74	430	3.3e-23	82.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q93Y91`	Arabidopsis thaliana	Sugar transport protein 5	47.609%	Swiss-Prot	moderate database homology
`Q7EZD7`	Oryza sativa subsp. japonica	Sugar transport protein MST3	44.330%	Swiss-Prot	moderate database homology
`Q0JCR9`	Oryza sativa subsp. japonica	Sugar transport protein MST1	44.583%	Swiss-Prot	moderate database homology
`Q94EC4`	Oryza sativa subsp. japonica	Sugar transport protein MST8	43.636%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card