TkA02G063280 | RubberDandelionOmics

Gene overview

TkA02G063280

Reference: TK1151 Chr: Chr02 Coordinates: 16485618-16487055 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA No cDNA sequence available

cDNA

No cDNA sequence is available for this reference.

CDS

Download CDS FASTA

360 bp · TkA02G063280|TK1151|CDS

GACGATGGGGGGAGAATAGAGTTTATTGCTGGGAAAACTAGTGTTGGGGATGCTGTTGATGGAGCAATCAAAATCTTCACTGTTGCAGTCACGATTGTTGTTGTGGCGGTTCCGGAAGGGCTTCCATTAGCTGTCACATTAACGCTGGCGTACTCGATGCGAAAAATGATGTCGGATAAAGCATTGGTTAGAAGGCTATCTGCTTGTGAAACAATGGGTTCCGCAACTACAATTTGCAGTGACAAAACCGGAACCTTGAC...

Protein

Download Protein FASTA

119 aa · TkA02G063280|TK1151|PROTEIN

DDGGRIEFIAGKTSVGDAVDGAIKIFTVAVTIVVVAVPEGLPLAVTLTLAYSMRKMMSDKALVRRLSACETMGSATTICSDKTGTLTLNMVPDNLSMVPNNSPLGNRRSSSESHHNNVI

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G063280`
TK1151 ID	TkA02G063280
OH-1004 ID	LXL04_023930
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	95.700
Protein coverage (%)	TK1151 98.319 / OH-1004 30.390 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G063280

Location Chr02:16485618-16487055 (-)

Description Similar to ACA5: Calcium-transporting ATPase 5, plasma membrane-type

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g21180`	This magnesium-dependent enzyme catalyzes the hydrolysis of ATP coupled with the translocation of calcium from the cytosol out of the cell or into organelles.	No verified direct reference in this release
`At5g57110`	This magnesium-dependent enzyme catalyzes the hydrolysis of ATP coupled with the translocation of calcium from the cytosol out of the cell.	No verified direct reference in this release
`At4g29900`	This magnesium-dependent enzyme catalyzes the hydrolysis of ATP coupled with the translocation of calcium from the cytosol into the endoplasmic reticulum.	No verified direct reference in this release
`At3g22910`	This magnesium-dependent enzyme catalyzes the hydrolysis of ATP coupled with the translocation of calcium from the cytosol out of the cell or into organelles.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os04g0605500`	This magnesium-dependent enzyme catalyzes the hydrolysis of ATP coupled with the translocation of calcium from the cytosol out of the cell, into the endoplasmic reticulum, or into organelles (By similarity).	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_023930 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009409 response to cold Biological Process

GO:0009414 response to water deprivation Biological Process

GO:0009555 pollen development Biological Process

GO:0009567 double fertilization forming a zygote and endosperm Biological Process

GO:0009624 response to nematode Biological Process

GO:0051480 regulation of cytosolic calcium ion concentration Biological Process

GO:0005634 nucleus Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009506 plasmodesma Cellular Component

GO:0009536 plastid Cellular Component

GO:0016020 membrane Cellular Component

GO:0005388 P-type calcium transporter activity Molecular Function

KEGG gene cross-reference

ath:AT3G21180

ath:AT3G63380

ath:AT4G29900

ath:AT5G57110

dosa:Os04g0605500

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.464

Rank 1 · TkA02G063280 · TK1151

Endoplasmic reticulum0.177

Rank 2 · TkA02G063280 · TK1151

Lysosome / Vacuole0.152

Rank 3 · TkA02G063280 · TK1151

Cytoplasm0.109

Rank 4 · TkA02G063280 · TK1151

Golgi apparatus0.094

Rank 5 · TkA02G063280 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF04540Herpes_UL5118-70 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G063280	`PF04540`	Herpes_UL51	18	70	0.052	14.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LU41`	Arabidopsis thaliana	sp\|Q9LU41\|ACA9_ARATH Calcium-transporting ATPase 9, plasma membrane-type	81.300%	Swiss-Prot	High
`Q9LF79`	Arabidopsis thaliana	sp\|Q9LF79\|ACA8_ARATH Calcium-transporting ATPase 8, plasma membrane-type	79.100%	Swiss-Prot	High
`Q9SZR1`	Arabidopsis thaliana	sp\|Q9SZR1\|ACA10_ARATH Calcium-transporting ATPase 10, plasma membrane-type	82.600%	Swiss-Prot	High
`Q9LIK7`	Arabidopsis thaliana	sp\|Q9LIK7\|ACA13_ARATH Putative calcium-transporting ATPase 13, plasma membrane-type	62.600%	Swiss-Prot	High
`Q7X8B5`	Oryza sativa subsp. japonica	sp\|Q7X8B5\|ACA5_ORYSJ Calcium-transporting ATPase 5, plasma membrane-type	78.400%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card