LXL04_023930 | RubberDandelionOmics

Gene overview

LXL04_023930

Reference: OH-1004 Chr: Chr05 Coordinates: 74654981-74657513 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1158 bp · LXL04_023930|LXL04_023930|OH1004|cDNA

ATGGATGCATTACCAGGTTTTAAAGGTGGCAATGCTGATTATGCCATGGATTTGCACCAGAAGGAACAGCTTCATGATCCCAATTTTTTCAATGATGCAGTCTCCACATTTCTCTGtgagttaaaaaaaattaaaATGGGGAGGTCTTCGGGGTTCAGCTTGGGAGGGGCATTTTCGTCACATCGTCCACAACAACAAACTAGCAGTGTCTCATCTTTTGCACCATCAAACAATCAAGAGCTTCACCATATGGATATGTT...

CDS

Download CDS FASTA

1158 bp · LXL04_023930|LXL04_023930|OH1004|CDS

ATGGATGCATTACCAGGTTTTAAAGGTGGCAATGCTGATTATGCCATGGATTTGCACCAGAAGGAACAGCTTCATGATCCCAATTTTTTCAATGATGCAGTCTCCACATTTCTCTGTGAGTTAAAAAAAATTAAAATGGGGAGGTCTTCGGGGTTCAGCTTGGGAGGGGCATTTTCGTCACATCGTCCACAACAACAAACTAGCAGTGTCTCATCTTTTGCACCATCAAACAATCAAGAGCTTCACCATATGGATATGTT...

Protein

Download Protein FASTA

385 aa · LXL04_023930|LXL04_023930|OH1004|PROTEIN

MDALPGFKGGNADYAMDLHQKEQLHDPNFFNDAVSTFLCELKKIKMGRSSGFSLGGAFSSHRPQQQTSSVSSFAPSNNQELHHMDMFQQGSHSSFHSQPEWELESESLMPMFMALVCQLWSPLKTACLKCVCKQGRTRLSCHRLSVNFYDHIFSISFFALPYTLITNQVPADGVLISGHSLSIDESSMTGESKIVHKDHKNPFLMSGCKVADGYGIMLASSVGIHTEWGLLMASISEDNGEETPLHVINSKLQGFFTGHT...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_023930`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_023930

Location Chr05:74654981-74657513 (+)

Description Similar to ACA5: Calcium-transporting ATPase 5, plasma membrane-type

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g21180`	This magnesium-dependent enzyme catalyzes the hydrolysis of ATP coupled with the translocation of calcium from the cytosol out of the cell or into organelles.	No verified direct reference in this release
`At5g57110`	This magnesium-dependent enzyme catalyzes the hydrolysis of ATP coupled with the translocation of calcium from the cytosol out of the cell.	No verified direct reference in this release
`At4g29900`	This magnesium-dependent enzyme catalyzes the hydrolysis of ATP coupled with the translocation of calcium from the cytosol into the endoplasmic reticulum.	No verified direct reference in this release
`At3g63380`	This magnesium-dependent enzyme catalyzes the hydrolysis of ATP coupled with the translocation of calcium from the cytosol out of the cell or into organelles.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os04g0605500`	This magnesium-dependent enzyme catalyzes the hydrolysis of ATP coupled with the translocation of calcium from the cytosol out of the cell, into the endoplasmic reticulum, or into organelles (By similarity).	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_023930 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0009409 response to cold Biological Process

GO:0009414 response to water deprivation Biological Process

GO:0009555 pollen development Biological Process

GO:0009567 double fertilization forming a zygote and endosperm Biological Process

GO:0009624 response to nematode Biological Process

GO:0051480 regulation of cytosolic calcium ion concentration Biological Process

GO:0005634 nucleus Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009506 plasmodesma Cellular Component

GO:0009536 plastid Cellular Component

GO:0016020 membrane Cellular Component

GO:0005388 P-type calcium transporter activity Molecular Function

KEGG gene cross-reference

ath:AT3G21180

ath:AT3G63380

ath:AT4G29900

ath:AT5G57110

dosa:Os04g0605500

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.280

Rank 1 · LXL04_023930 · OH-1004

Endoplasmic reticulum0.246

Rank 2 · LXL04_023930 · OH-1004

Nucleus0.228

Rank 3 · LXL04_023930 · OH-1004

Cell membrane0.191

Rank 4 · LXL04_023930 · OH-1004

Mitochondrion0.149

Rank 5 · LXL04_023930 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00122.26E1-E2_ATPase167-234 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_023930	`PF00122.26`	E1-E2_ATPase	167	234	2.4e-11	44.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LU41`	Arabidopsis thaliana	Calcium-transporting ATPase 9, plasma membrane-type	64.583%	Swiss-Prot	moderate database homology
`Q9LF79`	Arabidopsis thaliana	Calcium-transporting ATPase 8, plasma membrane-type	56.383%	Swiss-Prot	moderate database homology
`Q9SZR1`	Arabidopsis thaliana	Calcium-transporting ATPase 10, plasma membrane-type	59.836%	Swiss-Prot	moderate database homology
`Q9LY77`	Arabidopsis thaliana	Calcium-transporting ATPase 12, plasma membrane-type	54.589%	Swiss-Prot	weak database homology
`Q7X8B5`	Oryza sativa subsp. japonica	Calcium-transporting ATPase 5, plasma membrane-type	64.655%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card