TkA02G045530 | RubberDandelionOmics

Gene overview

TkA02G045530

Reference: TK1151 Chr: Chr02 Coordinates: 11733555-11737970 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2216 bp · TkA02G045530|TK1151|cDNA

TTTGCCTTCGTCCAATCTGATAGCACATAGAACGCAAACCAACAAGACGACGACTGATACTGCCGACAACCTCCCACAAGACACCTGGAACCGCCGTTCTCCACCGCTAACTACTCAGGCGATCAGAACAATCAATCAGCACTCTGAAGGAATTTAAAGACACAAATGGATACAGAATCTGCTAAGGCATCCGCGCCACCTCCTGTAACAGACTCAAATCCACAACCTGTTCCAGCTTCAGAATCCAAACATGATTCTAC...

CDS

Download CDS FASTA

1767 bp · TkA02G045530|TK1151|CDS

ATGGATACAGAATCTGCTAAGGCATCCGCGCCACCTCCTGTAACAGACTCAAATCCACAACCTGTTCCAGCTTCAGAATCCAAACATGATTCTACACAAGATTCACCATCAAAGCTGTCTGCTTCTGGGATAACCACATGGGCCAAAAGTCTGAAACTTCCACAGCCTTTAGGAGGCAGCAGCACCACCACACAAGATGACTCATCTCCATCTGAAAACACTGGTAGATTTGCTCGTTTGACTAGTGGACTAGGGTTACG...

Protein

Download Protein FASTA

588 aa · TkA02G045530|TK1151|PROTEIN

MDTESAKASAPPPVTDSNPQPVPASESKHDSTQDSPSKLSASGITTWAKSLKLPQPLGGSSTTTQDDSSPSENTGRFARLTSGLGLRLSPKTPQQDDGQSQTPDAGQTTPQTGIFGTITKGFVDTSKNAVKAVQVKARHVVSQNKRRYQEGGFDLDMTYITENVIAMGFPAGDMSSGFFGYVEGFYRNHMEEVVRYFETYHKDKYKVYNLCSERLYDASLFEGKVASFPFDDHNCPPIQLIISFCHSAYAWLKEDIENVV...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G045530`
TK1151 ID	TkA02G045530
OH-1004 ID	LXL04_017388
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	99.700
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G045530

Location Chr02:11733555-11737970 (+)

Description Similar to PTEN2A: Phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase and protein-tyrosine-phosphatase PTEN2A

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g19420`	Binds phosphatidic acid.	A novel class of PTEN protein in Arabidopsis displays unusual phosphoinositide phosphatase activity and efficiently binds phosphatidic acid.2012 · DOI: 10.1042/bj20110776
`At3g50110`	Protein tyrosine phosphatase that also exhibits a weak lipid phosphatase activity towards PtdIns(3)P.	A novel class of PTEN protein in Arabidopsis displays unusual phosphoinositide phosphatase activity and efficiently binds phosphatidic acid.2012 · DOI: 10.1042/bj20110776

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_017388 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0000281 mitotic cytokinesis Biological Process

GO:0006470 protein dephosphorylation Biological Process

GO:0006629 lipid metabolic process Biological Process

GO:0006935 chemotaxis Biological Process

GO:0006970 response to osmotic stress Biological Process

GO:0007056 spindle assembly involved in female meiosis Biological Process

GO:0007188 adenylate cyclase-modulating G protein-coupled receptor signaling pathway Biological Process

GO:0007584 response to nutrient Biological Process

GO:0008284 positive regulation of cell population proliferation Biological Process

GO:0008285 negative regulation of cell population proliferation Biological Process

GO:0009410 response to xenobiotic stimulus Biological Process

GO:0009651 response to salt stress Biological Process

KEGG gene cross-reference

ath:AT3G19420

ath:AT3G50110

ddi:DDB_G0286557

mmu:19211

rno:50557

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.565

Rank 1 · TkA02G045530 · TK1151

Cell membrane0.187

Rank 2 · TkA02G045530 · TK1151

Endoplasmic reticulum0.185

Rank 3 · TkA02G045530 · TK1151

Golgi apparatus0.152

Rank 4 · TkA02G045530 · TK1151

Nucleus0.147

Rank 5 · TkA02G045530 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF05706CDKN3203-283 aa

PF22741PTP-NADK225-281 aa

PF22785Tc-R-P226-280 aa

PF22784PTP-SAK229-289 aa

PF00102Y_phosphatase232-279 aa

PF13350Y_phosphatase3252-282 aa

PF00782DSPc257-299 aa

PF22918PTEN2_C2332-460 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G045530	`PF05706`	CDKN3	203	283	0.19	12.1
TkA02G045530	`PF22741`	PTP-NADK	225	281	0.005	17.0
TkA02G045530	`PF22785`	Tc-R-P	226	280	2e-06	29.0
TkA02G045530	`PF22784`	PTP-SAK	229	289	0.0025	18.6
TkA02G045530	`PF00102`	Y_phosphatase	232	279	0.0054	17.1
TkA02G045530	`PF13350`	Y_phosphatase3	252	282	0.021	15.5
TkA02G045530	`PF00782`	DSPc	257	299	0.00021	21.8
TkA02G045530	`PF22918`	PTEN2_C2	332	460	6.9e-75	249.9
TkA02G045530	`PF10409`	PTEN_C2	350	456	1.1e-05	25.9
TkA02G045530	`PF13350`	Y_phosphatase3	450	473	0.021	15.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LT75`	Arabidopsis thaliana	sp\|Q9LT75\|PTN2A_ARATH Phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase and protein-tyrosine-phosphatase PTEN2A	66.400%	Swiss-Prot	High
`Q8H106`	Arabidopsis thaliana	sp\|Q8H106\|PTN2B_ARATH Phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase and protein-tyrosine-phosphatase PTEN2B	60.500%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card