Gene Card
Gene overview
cDNA / CDS / Protein Sequences
618 bp · TkA02G042650|TK1151|cDNA
CTTATTTTCACGGACAAATGCATTGCGCGGGTACAATGTTACCTGAAGGAATGGCTCCATTCACACATATCACCCGAAATGAACGCTCAGGCAGAAAGCAAAGAAAGAAAAAAGAAGAAGATGATATAGCTGTCTGTGAATGCAAATTTGATCCTGGACATACTGTACTTGCATGTGGAGAAAGGTGTTTGAATGTATTAACCAATACAGAATGCACACCTGGATATTGCCCATGTGGCACCTTTTGCAAGAACCAGAGG...
450 bp · TkA02G042650|TK1151|CDS
ATGCATTGCGCGGGTACAATGTTACCTGAAGGAATGGCTCCATTCACACATATCACCCGAAATGAACGCTCAGGCAGAAAGCAAAGAAAGAAAAAAGAAGAAGATGATATAGCTGTCTGTGAATGCAAATTTGATCCTGGACATACTGTACTTGCATGTGGAGAAAGGTGTTTGAATGTATTAACCAATACAGAATGCACACCTGGATATTGCCCATGTGGCACCTTTTGCAAGAACCAGAGGTTTCAAAAATGTGAATA...
Protein
Download Protein FASTA149 aa · TkA02G042650|TK1151|PROTEIN
MHCAGTMLPEGMAPFTHITRNERSGRKQRKKKEEDDIAVCECKFDPGHTVLACGERCLNVLTNTECTPGYCPCGTFCKNQRFQKCEYAKTKLFKTEGRGWGLLADENIKAGQFIIEYSGEIISSEEAKARSQTYESQLSRIKRCIYYFS
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA02G042650 |
|---|---|
| TK1151 ID | TkA02G042650 |
| OH-1004 ID | LXL04_007462 |
| Relationship / confidence | Multi Source To Oh1004 / Complex relationship |
| Protein identity (%) | 97.700 |
| Protein coverage (%) | TK1151 89.262 / OH-1004 100.000Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA02G042650 | |||||||||
|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr02:10783947-10785183 (+) | |||||||||
| Description | No functional description available | |||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
RiceNo hit for this species in the current source table. | |||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | |||||||||
| GO annotations (OH1004 source) | GO:0000122 negative regulation of transcription by RNA polymerase II Biological Process GO:0006281 DNA repair Biological Process GO:0006302 double-strand break repair Biological Process GO:0006351 DNA-templated transcription Biological Process GO:0006355 regulation of DNA-templated transcription Biological Process GO:0007338 single fertilization Biological Process GO:0009553 embryo sac development Biological Process GO:0009555 pollen development Biological Process GO:0009791 post-embryonic development Biological Process GO:0009908 flower development Biological Process GO:0009910 negative regulation of flower development Biological Process GO:0010223 secondary shoot formation Biological Process | |||||||||
| KEGG gene cross-reference | ath:AT1G76710 ath:AT1G77300 hsa:7468 mmu:107823 mmu:192195 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF17907AWS51-85 aaPF00856SET54-54 aaPF00856SET99-145 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| TkA02G042650 | PF17907 | AWS | 51 | 85 | 1.8e-13 | 51.0 |
| TkA02G042650 | PF00856 | SET | 54 | 54 | 1.5e-06 | 29.3 |
| TkA02G042650 | PF00856 | SET | 99 | 145 | 1.5e-06 | 29.3 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.