RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

TkA02G021500
Reference: TK1151 Chr: Chr02 Coordinates: 5092081-5097332 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

774 bp · TkA02G021500|TK1151|cDNA

GTGATTTTCCTTATTTGTAATCCTCTTTATTTTTTGAAAAAGAAAATAACATATCAATGAAAATATAAATCCCGCGTGTGGCACGTACCACGTTATAGCTGTGTAGCAGGACTGTAGGAGTACCATTTCCCTCCCACCACTTCCATCTTCTCAAACCGAAAACTTCCAAATTTCTAGGGTTTTTGCATGGCATCTTCCGATGAAGAAGGCGAAATCGTGCCCGTTTGCGTCACAAACTACCACATTGTGAACGATCGTGA...

CDS

Download CDS FASTA

3120 bp · TkA02G021500|TK1151|CDS

ATGGCATCTTCCGATGAAGAAGGCGAAATCGTGCCCGTTTGCGTCACAAACTACCACATTGTGAACGATCGTGATGTTCCGACTTCATTTTCGGAGTTACCGCTTCGTTGGAGCGATCAGGAGAACCGAATCGAAAGTAAAGAGCCATCGGTTATGTATCTGCGGGGAGCTACGGACGGAGGTCTGCAAACAGTCCATAAGGAAGTGATCGCGTGGAAGTTGGACCTTTCGGATATAGTGCCTAAATTGTTCATGCTTTC...

Protein

Download Protein FASTA

1039 aa · TkA02G021500|TK1151|PROTEIN

MASSDEEGEIVPVCVTNYHIVNDRDVPTSFSELPLRWSDQENRIESKEPSVMYLRGATDGGLQTVHKEVIAWKLDLSDIVPKLFMLSKGKTWIKLQKPRKSYENVIKSVKIAVRCLHFVKRNADAGRDQISRHLVKTFSSYDEIGPVEEYLSAHLPLIQTAVARDKDLAKSKYFKTFLTEIENPRRRDYQLEQNHSKNKSKFIVSDDDEEHDEDFDDDNEDEDEDEEVLFYSVCAFCDNGGDVLPCEGNCMRSFHPTIDA...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDTkA02G021500
TK1151 IDTkA02G021500
OH-1004 IDLXL04_017609
Relationship / confidenceRbh High Identity Coverage Synteny / Strict
Protein identity (%)98.000
Protein coverage (%)TK1151 100.000 / OH-1004 100.000
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionTK1151 / GWHBCHF00000000
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDTkA02G021500
LocationChr02:5092081-5097332 (+)
DescriptionSimilar to EDM2: Protein ENHANCED DOWNY MILDEW 2
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
At5g55390 Cellular antisilencing factor and regulator of genome DNA methylation patterns involved in the regulation of chromatin states.
EDM2 is required for RPP7-dependent disease resistance in Arabidopsis and affects RPP7 transcript levels.2007 · DOI: 10.1111/j.1365-313x.2006.02999.x
The Arabidopsis defense component EDM2 affects the floral transition in an FLC-dependent manner.2010 · DOI: 10.1111/j.1365-313x.2010.04169.x
Co-option of EDM2 to distinct regulatory modules in Arabidopsis thaliana development.2010 · DOI: 10.1186/1471-2229-10-203
EMSY-like genes are required for full RPP7-mediated race-specific immunity and basal defense in Arabidopsis.2011 · DOI: 10.1094/mpmi-05-11-0123
Mutations in EDM2 selectively affect silencing states of transposons and induce plant developmental plasticity.2013 · DOI: 10.1038/srep01701
Antagonistic regulation of flowering time through distinct regulatory subunits of protein phosphatase 2A.2013 · DOI: 10.1371/journal.pone.0067987
Arabidopsis EDM2 promotes IBM1 distal polyadenylation and regulates genome DNA methylation patterns.2014 · DOI: 10.1073/pnas.1320106110
Demethylation of ERECTA receptor genes by IBM1 histone demethylase affects stomatal development.2016 · DOI: 10.1242/dev.129932
A protein complex regulates RNA processing of intronic heterochromatin-containing genes in Arabidopsis .2017 · DOI: 10.1073/pnas.1710683114
The Arabidopsis RRM domain protein EDM3 mediates race-specific disease resistance by controlling H3K9me2-dependent alternative polyadenylation of RPP7 immune receptor transcripts.2019 · DOI: 10.1111/tpj.14148
The Arabidopsis PHD-finger protein EDM2 has multiple roles in balancing NLR immune receptor gene expression.2020 · DOI: 10.1371/journal.pgen.1008993
Genome-wide distribution and functions of the AAE complex in epigenetic regulation in Arabidopsis.2021 · DOI: 10.1111/jipb.13068

Rice

No hit for this species in the current source table.

Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_017609 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)
GO:0006338 chromatin remodeling Biological Process
GO:0006351 DNA-templated transcription Biological Process
GO:0006355 regulation of DNA-templated transcription Biological Process
GO:0007165 signal transduction Biological Process
GO:0009911 positive regulation of flower development Biological Process
GO:0010228 vegetative to reproductive phase transition of meristem Biological Process
GO:0010440 stomatal lineage progression Biological Process
GO:0031347 regulation of defense response Biological Process
GO:0031452 negative regulation of heterochromatin formation Biological Process
GO:0032259 methylation Biological Process
GO:0040029 epigenetic regulation of gene expression Biological Process
GO:0045892 negative regulation of DNA-templated transcription Biological Process
KEGG gene cross-reference
ath:AT5G55390
ddi:DDB_G0268158
hsa:54904
mmu:234135
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.948
Rank 1 · TkA02G021500 · TK1151
Cytoplasm0.099
Rank 2 · TkA02G021500 · TK1151
Cell membrane0.024
Rank 3 · TkA02G021500 · TK1151
Endoplasmic reticulum0.014
Rank 4 · TkA02G021500 · TK1151
Plastid0.012
Rank 5 · TkA02G021500 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF12047DNMT1-RFD15-124 aa
PF25760Phage_RB18_ORF43100-135 aa
PF19975DO-GTPase1113-214 aa
PF12047DNMT1-RFD189-224 aa
PF23011PHD-1st_NSD232-255 aa
PF16866PHD_4232-239 aa
PF22908PHD_NSD234-256 aa
PF00628PHD234-256 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
TkA02G021500PF12047DNMT1-RFD151241.2e-0732.5
TkA02G021500PF25760Phage_RB18_ORF431001350.04414.3
TkA02G021500PF19975DO-GTPase11132140.6310.0
TkA02G021500PF12047DNMT1-RFD1892241.2e-0732.5
TkA02G021500PF23011PHD-1st_NSD2322550.0004221.1
TkA02G021500PF16866PHD_42322390.3811.4
TkA02G021500PF22908PHD_NSD2342561.9e-1970.4
TkA02G021500PF00628PHD2342560.009216.7
TkA02G021500PF21202SLX1_C2412514.68.4
TkA02G021500PF00628PHD2822940.009216.7
TkA02G021500PF23412zf_RING_Vps82822921.79.2
TkA02G021500PF22908PHD_NSD2913591.9e-1970.4
TkA02G021500PF14446Prok-RING_12913312.78.9
TkA02G021500PF16866PHD_42923320.3811.4
TkA02G021500PF21202SLX1_C2943354.68.4
TkA02G021500PF23004PHDvar_NSD2953339e-0626.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
F4K3G5Arabidopsis thalianasp|F4K3G5|EDM2_ARATH Protein ENHANCED DOWNY MILDEW 243.700%Swiss-ProtMedium

JBrowse

View in Genome Browser