RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

TkA02G017250
Reference: TK1151 Chr: Chr02 Coordinates: 4052484-4055970 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

1889 bp · TkA02G017250|TK1151|cDNA

GGAGTGGTAAATATCAAGATGGTATGGTGTGTGTAATGTGGTGTGACATGACACCCACCATATTTCTTTGGTATTATTAATGTTCTATTTGGTTTTGCAAAACCCCTTTCATTCTATCTCTCAGAATTGCGTGTGCCTTAGACGAGGGAAATTTCAAGAAAATGTCACTGGGGTATGCAGAGAAGCTCTCCTATAAAGAAGACGTTGGGGATGTCGGAATGTCCGAGATGTTCGACTCGCCAGATGATTTGCAACAAAAA...

CDS

Download CDS FASTA

1416 bp · TkA02G017250|TK1151|CDS

ATGTCACTGGGGTATGCAGAGAAGCTCTCCTATAAAGAAGACGTTGGGGATGTCGGAATGTCCGAGATGTTCGACTCGCCAGATGATTTGCAACAAAAAATTAACCAGCTCGCAAATATGATTAAAAAGAGTAAGCATCTAGTGGCATTTACAGGTGCAGGAATCTCAACTTCTTGTGGGATACCTGATTTTCGAGGCCCAAAAGGCGTTTGGACTCTTCAGCGTGAGGGCAAAGGTATTCCAGAAGCATCCTTGCCATT...

Protein

Download Protein FASTA

471 aa · TkA02G017250|TK1151|PROTEIN

MSLGYAEKLSYKEDVGDVGMSEMFDSPDDLQQKINQLANMIKKSKHLVAFTGAGISTSCGIPDFRGPKGVWTLQREGKGIPEASLPFHRASPSLTHMALVGLEKAGILKFVISQNVDSLHLRSGIPRNKLSELHGNSFREVCPSCGTEYLRDFEVETIGFKDTSRRCSDAKCGAKLKDSVLDWEDELPPTETNAAEKHCRMADIVLCLGTSLQITPACNLPLKSVRKGGKMVIVNLQETPKDKKASLVIRGFVDKVMAGV...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDTkA02G017250
TK1151 IDTkA02G017250
OH-1004 IDLXL04_031047
Relationship / confidenceRbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)62.400
Protein coverage (%)TK1151 92.994 / OH-1004 93.590
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionTK1151 / GWHBCHF00000000
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDTkA02G017250
LocationChr02:4052484-4055970 (-)
DescriptionSimilar to SRT1: NAD-dependent protein deacetylase SRT1
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
At5g55760 NAD-dependent protein deacetylase (By similarity).
Histone Deacetylases SRT1 and SRT2 Interact with ENAP1 to Mediate Ethylene-Induced Transcriptional Repression.2018 · DOI: 10.1105/tpc.17.00671

Rice

Reference gene IDPossible functionPapers / DOI
UniProt: B8ARK7 NAD-dependent protein deacetylase. No verified direct reference in this release
Os04g0271000 NAD-dependent protein deacetylase. No verified direct reference in this release
Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_031047 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)
GO:0000122 negative regulation of transcription by RNA polymerase II Biological Process
GO:0006302 double-strand break repair Biological Process
GO:0006606 protein import into nucleus Biological Process
GO:0008340 determination of adult lifespan Biological Process
GO:0009411 response to UV Biological Process
GO:0009873 ethylene-activated signaling pathway Biological Process
GO:0010526 transposable element silencing Biological Process
GO:0010569 regulation of double-strand break repair via homologous recombination Biological Process
GO:0019216 regulation of lipid metabolic process Biological Process
GO:0031508 pericentric heterochromatin formation Biological Process
GO:0031509 subtelomeric heterochromatin formation Biological Process
GO:0031648 protein destabilization Biological Process
KEGG gene cross-reference
ath:AT5G55760
dosa:Os04g0271000
osa:4335342
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.703
Rank 1 · TkA02G017250 · TK1151
Cytoplasm0.314
Rank 2 · TkA02G017250 · TK1151
Mitochondrion0.083
Rank 3 · TkA02G017250 · TK1151
Cell membrane0.040
Rank 4 · TkA02G017250 · TK1151
Endoplasmic reticulum0.029
Rank 5 · TkA02G017250 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00205TPP_enzyme_M34-58 aa
PF02146SIR252-74 aa
PF02146SIR288-216 aa
PF26788DUF8260128-148 aa
PF07282Cas12f1-like_TNB141-153 aa
PF13240Zn_Ribbon_1142-149 aa
PF07282Cas12f1-like_TNB154-176 aa
PF13240Zn_Ribbon_1171-178 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
TkA02G017250PF00205TPP_enzyme_M34580.0116.3
TkA02G017250PF02146SIR252741e-2694.7
TkA02G017250PF02146SIR2882161e-2694.7
TkA02G017250PF26788DUF82601281480.1612.7
TkA02G017250PF07282Cas12f1-like_TNB1411530.1812.7
TkA02G017250PF13240Zn_Ribbon_11421490.1412.6
TkA02G017250PF07282Cas12f1-like_TNB1541760.1812.7
TkA02G017250PF13240Zn_Ribbon_11711780.1412.6
TkA02G017250PF26788DUF82601711940.1612.7
TkA02G017250PF00205TPP_enzyme_M1902420.0116.3
TkA02G017250PF13240Zn_Ribbon_13964010.1412.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
Q9FE17Arabidopsis thalianasp|Q9FE17|SIR1_ARATH NAD-dependent protein deacetylase SRT163.300%Swiss-ProtHigh
B8ARK7Oryza sativa subsp. indicasp|B8ARK7|SRT1_ORYSI NAD-dependent protein deacetylase SRT162.300%Swiss-ProtHigh
Q7XWV4Oryza sativa subsp. japonicasp|Q7XWV4|SRT1_ORYSJ NAD-dependent protein deacetylase SRT162.300%Swiss-ProtHigh

JBrowse

View in Genome Browser