TkA01G631780 | RubberDandelionOmics

Gene overview

TkA01G631780

Reference: TK1151 Chr: Chr01 Coordinates: 159802116-159804404 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1749 bp · TkA01G631780|TK1151|cDNA

ATGGCGGACGACGCTGGGGAACCAATTTACTTGAAGGTGGAACTTAATCTGCGAGGTAATTTTGTTCGTAACCCACATGGGTATGTCGGAGAACGTTACTTGGTTACCGACATGGATTTCCCTGCACTTGATTTCGATGATTTTATTTCATATTTGGAAAGATTCACTGGAGAAACTTTTGAAAAGGTCTACTACTCCCAAAGACACGTACCTTTCAAAATGGGTATTAGGTACATTGAAGATGATGCAGACTATGCTTT...

CDS

Download CDS FASTA

1749 bp · TkA01G631780|TK1151|CDS

ATGGCGGACGACGCTGGGGAACCAATTTACTTGAAGGTGGAACTTAATCTGCGAGGTAATTTTGTTCGTAACCCACATGGGTATGTCGGAGAACGTTACTTGGTTACCGACATGGATTTCCCTGCACTTGATTTCGATGATTTTATTTCATATTTGGAAAGATTCACTGGAGAAACTTTTGAAAAGGTCTACTACTCCCAAAGACACGTACCTTTCAAAATGGGTATTAGGTACATTGAAGATGATGCAGACTATGCTTT...

Protein

Download Protein FASTA

582 aa · TkA01G631780|TK1151|PROTEIN

MADDAGEPIYLKVELNLRGNFVRNPHGYVGERYLVTDMDFPALDFDDFISYLERFTGETFEKVYYSQRHVPFKMGIRYIEDDADYAFFLDTALEEPLLPISIYLDHSGDGLAELFDTESDGSGNVVNGDDSANEVTGFNPEEDYFPDAHRFNAGLEDEIIHDETVDANLNKTNGDEFLNWRLQSPVMGMKFENPAQLKEMLCNYAISNGYHLRNFKLGTLVTYQWIGSHYTKDIWHRQKLTIRQLRLEVIKKFGIDVSLS...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G631780`
TK1151 ID	TkA01G631780
OH-1004 ID	LXL04_011567
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	57.700
Protein coverage (%)	TK1151 66.838 / OH-1004 49.414 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA01G631780`
Location	Chr01:159802116-159804404 (-)
Description	Similar to XTH33: Probable xyloglucan endotransglucosylase/hydrolase protein 33
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_011567` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0009831 plant-type cell wall modification involved in multidimensional cell growth Biological Process GO:0010087 phloem or xylem histogenesis Biological Process GO:0010154 fruit development Biological Process GO:0010411 xyloglucan metabolic process Biological Process GO:0042546 cell wall biogenesis Biological Process GO:0071555 cell wall organization Biological Process GO:0080086 stamen filament development Biological Process GO:0005576 extracellular region Cellular Component GO:0005886 plasma membrane Cellular Component GO:0048046 apoplast Cellular Component GO:0004553 hydrolase activity, hydrolyzing O-glycosyl compounds Molecular Function GO:0016762 xyloglucan:xyloglucosyl transferase activity Molecular Function
KEGG gene cross-reference	ath:AT1G10550 ath:AT1G14720 ath:AT1G32170 ath:AT2G01850 ath:AT4G18990 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.867

Rank 1 · TkA01G631780 · TK1151

Cytoplasm0.170

Rank 2 · TkA01G631780 · TK1151

Cell membrane0.032

Rank 3 · TkA01G631780 · TK1151

Endoplasmic reticulum0.032

Rank 4 · TkA01G631780 · TK1151

Mitochondrion0.025

Rank 5 · TkA01G631780 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF11149DUF2924170-230 aa

PF00872Transposase_mut316-353 aa

PF10551MULE319-350 aa

PF11149DUF2924444-485 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G631780	`PF11149`	DUF2924	170	230	0.13	13.3
TkA01G631780	`PF00872`	Transposase_mut	316	353	1.6e-05	24.7
TkA01G631780	`PF10551`	MULE	319	350	4.8e-05	24.4
TkA01G631780	`PF11149`	DUF2924	444	485	0.13	13.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card