TkA01G625230 | RubberDandelionOmics

Gene overview

TkA01G625230

Reference: TK1151 Chr: Chr01 Coordinates: 157839408-157840647 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

995 bp · TkA01G625230|TK1151|cDNA

ATAACCGAAGAAACACTTGAAGTACACACACATTAATTTCCCTCTCACACTCCCGACAAAGCATGCATTCAGACCATTACCATCCCACTCCCACCACCATTCCAGCCACCACTGTCGACGAACACCAGTCTAGTCGCCATCACCTTCCGCCGAAGATGCTTCTCCAAGCGTTATGCTCTCGCAGTAGCGTTACCAATAATCAATCGTTGGTGTTAGATCGGTACCCTTTCGATTATTCACTAACGGATTCTTCACTACCT...

CDS

Download CDS FASTA

744 bp · TkA01G625230|TK1151|CDS

ATGCATTCAGACCATTACCATCCCACTCCCACCACCATTCCAGCCACCACTGTCGACGAACACCAGTCTAGTCGCCATCACCTTCCGCCGAAGATGCTTCTCCAAGCGTTATGCTCTCGCAGTAGCGTTACCAATAATCAATCGTTGGTGTTAGATCGGTACCCTTTCGATTATTCACTAACGGATTCTTCACTACCTGTTCGCTCCGTCTCATCTTCGTCGGCGTCTATAAATCACAAAGAAGCGGAGAAGCGCCGGAG...

Protein

Download Protein FASTA

247 aa · TkA01G625230|TK1151|PROTEIN

MHSDHYHPTPTTIPATTVDEHQSSRHHLPPKMLLQALCSRSSVTNNQSLVLDRYPFDYSLTDSSLPVRSVSSSSASINHKEAEKRRRERINFHLNRLRTLLPCNSKTDKASLLAKVVERLKELKQTTSEMEHRETLPSETDEITVISLNNNQSNGRIVIKASMCCDDRSDLLTDMIQTLKSLQLSPSRLEMVTVGGRIRNIVLMECDYRGDDCSELVHCLKEALSCLIKSNLGSIQSSKRRKMLVCT

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G625230`
TK1151 ID	TkA01G625230
OH-1004 ID	LXL04_000251
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.600
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G625230

Location Chr01:157839408-157840647 (+)

Description Similar to BHLH107: Putative transcription factor bHLH107

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g41130`	Transcription factor bHLH106.	No verified direct reference in this release
`At3g56770`	Putative transcription factor bHLH107.	No verified direct reference in this release
`At1g68810`	Transcription factor bHLH30.	No verified direct reference in this release
`At3g25710`	Transcription factor required for MONOPTEROS-dependent root initiation in embryo.	MONOPTEROS controls embryonic root initiation by regulating a mobile transcription factor.2010 · DOI: 10.1038/nature08836
`At2g40200`	Transcription factor bHLH51.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_000251 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0009718 anthocyanin-containing compound biosynthetic process Biological Process

GO:0016036 cellular response to phosphate starvation Biological Process

GO:0042538 hyperosmotic salinity response Biological Process

GO:0048364 root development Biological Process

GO:0080147 root hair cell development Biological Process

GO:0005634 nucleus Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009941 chloroplast envelope Cellular Component

GO:0003677 DNA binding Molecular Function

GO:0003700 DNA-binding transcription factor activity Molecular Function

KEGG gene cross-reference

ath:AT1G68810

ath:AT2G40200

ath:AT2G41130

ath:AT3G25710

ath:AT3G56770

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.976

Rank 1 · TkA01G625230 · TK1151

Cytoplasm0.086

Rank 2 · TkA01G625230 · TK1151

Cell membrane0.023

Rank 3 · TkA01G625230 · TK1151

Endoplasmic reticulum0.015

Rank 4 · TkA01G625230 · TK1151

Plastid0.011

Rank 5 · TkA01G625230 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF15341SLX972-147 aa

PF00010HLH78-124 aa

PF23177bHLH_IRO380-139 aa

PF23183bHLH_NPAS480-111 aa

PF23173bHLH_SAC5183-127 aa

PF22754bHLH-TF_ACT-like_plant109-124 aa

PF22754bHLH-TF_ACT-like_plant162-198 aa

PF23177bHLH_IRO3166-189 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G625230	`PF15341`	SLX9	72	147	1.4	10.1
TkA01G625230	`PF00010`	HLH	78	124	2.2e-10	40.9
TkA01G625230	`PF23177`	bHLH_IRO3	80	139	0.00046	21.2
TkA01G625230	`PF23183`	bHLH_NPAS4	80	111	0.0049	17.5
TkA01G625230	`PF23173`	bHLH_SAC51	83	127	0.011	16.4
TkA01G625230	`PF22754`	bHLH-TF_ACT-like_plant	109	124	0.065	14.1
TkA01G625230	`PF22754`	bHLH-TF_ACT-like_plant	162	198	0.065	14.1
TkA01G625230	`PF23177`	bHLH_IRO3	166	189	0.00046	21.2
TkA01G625230	`PF00010`	HLH	171	182	2.2e-10	40.9
TkA01G625230	`PF23173`	bHLH_SAC51	173	185	0.011	16.4
TkA01G625230	`PF15341`	SLX9	231	244	1.4	10.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O80674`	Arabidopsis thaliana	sp\|O80674\|BH106_ARATH Transcription factor bHLH106	45.100%	Swiss-Prot	Medium
`Q9LET0`	Arabidopsis thaliana	sp\|Q9LET0\|BH107_ARATH Putative transcription factor bHLH107	50.600%	Swiss-Prot	Medium
`Q9S7Y1`	Arabidopsis thaliana	sp\|Q9S7Y1\|BH030_ARATH Transcription factor bHLH30	46.900%	Swiss-Prot	Medium
`Q9LS08`	Arabidopsis thaliana	sp\|Q9LS08\|BH032_ARATH Transcription factor AIG1	50.000%	Swiss-Prot	Medium
`Q9XEF0`	Arabidopsis thaliana	sp\|Q9XEF0\|BH051_ARATH Transcription factor bHLH51	40.800%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card