LXL04_000251 | RubberDandelionOmics

Gene overview

LXL04_000251

Reference: OH-1004 Chr: Chr01 Coordinates: 4740771-4741759 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

744 bp · LXL04_000251|LXL04_000251|OH1004|cDNA

ATGCATTCAGACCATTACCATCCCACTCCCACCACCATTCCAGCCACCACTGTCGACGAACACCAGTCTAGTCGCCATCACCTTCCGCCGAAGATGCTTCTCCAAGCGTTATGCTCTCGCAGTAGCGTTACCAATAATCAATCGTTGGTGTTAGATCGGTACCCTTTCGATTATTCACTAACGGATTCTTCACTACCTGTTCGCTCTGTCTCATCTTCGTCGGCGTCTATAAATCACAAAGAAGCGGAGAAGCGCCGGAG...

CDS

Download CDS FASTA

744 bp · LXL04_000251|LXL04_000251|OH1004|CDS

ATGCATTCAGACCATTACCATCCCACTCCCACCACCATTCCAGCCACCACTGTCGACGAACACCAGTCTAGTCGCCATCACCTTCCGCCGAAGATGCTTCTCCAAGCGTTATGCTCTCGCAGTAGCGTTACCAATAATCAATCGTTGGTGTTAGATCGGTACCCTTTCGATTATTCACTAACGGATTCTTCACTACCTGTTCGCTCTGTCTCATCTTCGTCGGCGTCTATAAATCACAAAGAAGCGGAGAAGCGCCGGAG...

Protein

Download Protein FASTA

247 aa · LXL04_000251|LXL04_000251|OH1004|PROTEIN

MHSDHYHPTPTTIPATTVDEHQSSRHHLPPKMLLQALCSRSSVTNNQSLVLDRYPFDYSLTDSSLPVRSVSSSSASINHKEAEKRRRERINFHLNRLRTLLPCNSKTDKASLLAKVVERLKELKQTTSEMEHRETLPGETDEITVISLNNNQSNGRIVIKASMCCDDRSDLLTDMIQTLKSLQLSPSRLEMVTVGGRIRNIVLMECDYRGDDCSELVHCLKEALSCLIKSNLGSIQSSKRRKMLVCT

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_000251`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_000251

Location Chr01:4740771-4741759 (-)

Description Similar to BHLH107: Putative transcription factor bHLH107

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g56770`	Putative transcription factor bHLH107.	No verified direct reference in this release
`At2g41130`	Transcription factor bHLH106.	No verified direct reference in this release
`At1g68810`	Transcription factor bHLH30.	No verified direct reference in this release
`At3g25710`	Transcription factor required for MONOPTEROS-dependent root initiation in embryo.	MONOPTEROS controls embryonic root initiation by regulating a mobile transcription factor.2010 · DOI: 10.1038/nature08836
`At2g40200`	Transcription factor bHLH51.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_000251 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0009718 anthocyanin-containing compound biosynthetic process Biological Process

GO:0016036 cellular response to phosphate starvation Biological Process

GO:0042538 hyperosmotic salinity response Biological Process

GO:0048364 root development Biological Process

GO:0080147 root hair cell development Biological Process

GO:0005634 nucleus Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009941 chloroplast envelope Cellular Component

GO:0003677 DNA binding Molecular Function

GO:0003700 DNA-binding transcription factor activity Molecular Function

KEGG gene cross-reference

ath:AT1G68810

ath:AT2G40200

ath:AT2G41130

ath:AT3G25710

ath:AT3G56770

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.976

Rank 1 · LXL04_000251 · OH-1004

Cytoplasm0.086

Rank 2 · LXL04_000251 · OH-1004

Cell membrane0.023

Rank 3 · LXL04_000251 · OH-1004

Endoplasmic reticulum0.016

Rank 4 · LXL04_000251 · OH-1004

Plastid0.011

Rank 5 · LXL04_000251 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00010.32HLH78-124 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_000251	`PF00010.32`	HLH	78	124	2.2e-10	40.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LET0`	Arabidopsis thaliana	Putative transcription factor bHLH107	50.000%	Swiss-Prot	moderate database homology
`O80674`	Arabidopsis thaliana	Transcription factor bHLH106	53.896%	Swiss-Prot	moderate database homology
`Q9S7Y1`	Arabidopsis thaliana	Transcription factor bHLH30	46.629%	Swiss-Prot	moderate database homology
`Q9LS08`	Arabidopsis thaliana	Transcription factor AIG1	48.630%	Swiss-Prot	moderate database homology
`Q9XEF0`	Arabidopsis thaliana	Transcription factor bHLH51	45.588%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card