TkA01G621240 | RubberDandelionOmics

Gene overview

TkA01G621240

Reference: TK1151 Chr: Chr01 Coordinates: 156767984-156775951 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1257 bp · TkA01G621240|TK1151|cDNA

TTTGCATTTTGCAATTTTGTCTAAATTAATTTAATTTACTACTATTATAATCGGTCAATTTATGTCTTTCCTTCCTAGAGAAAACCAATGTCTTGGTCCTCTTGGAAGTTGGAAACTCTGTCTTCCTACCAAACTCGTATCAAACACTGATAGTTCTCTGGTTCACCGATCAATTATCGTAGCGAAGTTCGGTAATGGCGATCAGATCACTTCTAAAACTTGCAGAATCCAAATTCATCTTCACTTCCCCTCACTTTTCC...

CDS

Download CDS FASTA

1041 bp · TkA01G621240|TK1151|CDS

ATGGCGATCAGATCACTTCTAAAACTTGCAGAATCCAAATTCATCTTCACTTCCCCTCACTTTTCCCTACCGTCTTCATTTAGAACAATTTCTTCGTCGATCATTCCATCTCACTTGGAAAAGGTTGGATTCATAGGCTTAGGAAACATGGGATCCAGAATGGCAACTAATTTGATCAAAGCAGGATACAATGTTGCAGTTCATGACATAAATCTGAGTGTCATAAAGATGTTTTCAGACAAAGGAATCTCTGTAAAAGG...

Protein

Download Protein FASTA

346 aa · TkA01G621240|TK1151|PROTEIN

MAIRSLLKLAESKFIFTSPHFSLPSSFRTISSSIIPSHLEKVGFIGLGNMGSRMATNLIKAGYNVAVHDINLSVIKMFSDKGISVKGSPMEVAEMSDVVITMLPSPTHVLDVYTGQNGLLNGGSPIRPWLFIDSSTIDPQTTRNLSSLISNSALNQSKDSPVMLDAPVSGGVLAAEIGTLTFMVGGPEEAYKAAQPLFSSMGKNTIYCGSSGTGSAAKICNNLAMAVSMLGVSEAFVLGQSLGIKASILTKIFNSSSARC...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G621240`
TK1151 ID	TkA01G621240
OH-1004 ID	LXL04_000308
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.100
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G621240

Location Chr01:156767984-156775951 (+)

Description Similar to At4g20930: Probable 3-hydroxyisobutyrate dehydrogenase, mitochondrial

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g20930`	Probable 3-hydroxyisobutyrate dehydrogenase, mitochondrial.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_000308 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006551 L-leucine metabolic process Biological Process

GO:0006573 valine metabolic process Biological Process

GO:0006574 L-valine catabolic process Biological Process

GO:0005739 mitochondrion Cellular Component

GO:0005759 mitochondrial matrix Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0008442 3-hydroxyisobutyrate dehydrogenase activity Molecular Function

GO:0042803 protein homodimerization activity Molecular Function

GO:0050661 NADP binding Molecular Function

GO:0051287 NAD binding Molecular Function

KEGG gene cross-reference

ath:AT4G20930

bta:512002

hsa:11112

mmu:58875

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Mitochondrion0.731

Rank 1 · TkA01G621240 · TK1151

Plastid0.225

Rank 2 · TkA01G621240 · TK1151

Cytoplasm0.093

Rank 3 · TkA01G621240 · TK1151

Nucleus0.049

Rank 4 · TkA01G621240 · TK1151

Peroxisome0.020

Rank 5 · TkA01G621240 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01488Shikimate_DH39-111 aa

PF028262-Hacid_dh_C40-105 aa

PF03446NAD_binding_241-209 aa

PF03807F420_oxidored41-104 aa

PF027373HCDH_N41-76 aa

PF07991KARI_N41-108 aa

PF03721UDPG_MGDP_dh_N41-85 aa

PF02558ApbA43-92 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G621240	`PF01488`	Shikimate_DH	39	111	0.094	13.5
TkA01G621240	`PF02826`	2-Hacid_dh_C	40	105	3.1e-07	30.6
TkA01G621240	`PF03446`	NAD_binding_2	41	209	2.3e-43	148.7
TkA01G621240	`PF03807`	F420_oxidored	41	104	2.7e-08	35.0
TkA01G621240	`PF02737`	3HCDH_N	41	76	0.00038	21.1
TkA01G621240	`PF07991`	KARI_N	41	108	0.00099	19.4
TkA01G621240	`PF03721`	UDPG_MGDP_dh_N	41	85	0.068	13.6
TkA01G621240	`PF02558`	ApbA	43	92	0.044	14.1
TkA01G621240	`PF02254`	TrkA_N	45	85	0.035	15.1
TkA01G621240	`PF03721`	UDPG_MGDP_dh_N	132	152	0.068	13.6
TkA01G621240	`PF05710`	Coiled	145	160	1.9	10.1
TkA01G621240	`PF05710`	Coiled	199	255	1.9	10.1
TkA01G621240	`PF03807`	F420_oxidored	202	229	2.7e-08	35.0
TkA01G621240	`PF14833`	NAD_binding_11	212	337	3.6e-26	92.5
TkA01G621240	`PF21761`	RedAm-like_C	228	337	0.24	12.4
TkA01G621240	`PF02826`	2-Hacid_dh_C	294	320	3.1e-07	30.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SUC0`	Arabidopsis thaliana	sp\|Q9SUC0\|3HIDH_ARATH Probable 3-hydroxyisobutyrate dehydrogenase, mitochondrial	65.900%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card