RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

TkA01G616810
Reference: TK1151 Chr: Chr01 Coordinates: 155610115-155613889 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

1473 bp · TkA01G616810|TK1151|cDNA

CGATTTAGGAAAACTCGACAAATTGGCCCAATTCCGACTTTTACCCCGTTTCAAAAGAGCCCTAATTCAAGCTTTTGGAAGAACGAAGGTCTTTGCGGGTACCCTTTGAATTCCTTTTGCGGGAATTCAAACGGGTCAGATGAAATGTTACATCACAAAGTTTCTTACCGGACCGTGTTGGCTGTTATCGGGTCGGGTTTAATGGTGTTTTTATCAGTCACTGTCGTCGTTCTTTTGTTTATGATGAGAGAGAAGCAAGA...

CDS

Download CDS FASTA

2703 bp · TkA01G616810|TK1151|CDS

ATGGCGAATTTGTGCTTGTTCTTGATATTGATAATTGGGGTTCTTTCATGTTGCCAAAAGCCTGCGAGTTGTCAAGTCATCGATGACGATGATGATCTTTTGACTTTGTTAGCCATTAACAAGGAGCTTAGAGTGCTCGATTGGGGGGAAAACGGACTTAAGAACAGCTCAAATTACTGCATGTGGCCTCACATTACTTGTACCTCCGATCAATCGTCTGTCGAAAAGCTTGTTCTTTCTCATCAAAGTCTACAAGGTAA...

Protein

Download Protein FASTA

900 aa · TkA01G616810|TK1151|PROTEIN

MANLCLFLILIIGVLSCCQKPASCQVIDDDDDLLTLLAINKELRVLDWGENGLKNSSNYCMWPHITCTSDQSSVEKLVLSHQSLQGNLTLLSQLKSLKWLDLSFNTFHGSIPQSFGNLSELEFLDLSYNKFDGSIPTELGKLKNLKSLNLSNNLLMGSIPNELEGLVKLQDFQIYSNHFNGSIPIWVGNLTNLKVFTAYENELNGKIPETLGSLSELQLLNLHSNYLEGSIPTSVFTSGKLEFLVLTQNKLSGTLPEEIG...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDTkA01G616810
TK1151 IDTkA01G616810
OH-1004 IDLXL04_000371
Relationship / confidenceRbh High Identity Coverage Synteny / Strict
Protein identity (%)99.700
Protein coverage (%)TK1151 100.000 / OH-1004 100.000
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionTK1151 / GWHBCHF00000000
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDTkA01G616810
LocationChr01:155610115-155613889 (-)
DescriptionSimilar to PXC3: Leucine-rich repeat receptor-like tyrosine-protein kinase PXC3
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
At2g41820 Leucine-rich repeat receptor-like protein kinase that may play a role in vascular tissues development. No verified direct reference in this release
At5g61480 Acts with CLE41p and CLE44p peptides as a ligand-receptor pair in a signal transduction pathway involved in the regulation of procambium maintenance and polarity during vascular-tissue development. No verified direct reference in this release
At5g63930 Probable leucine-rich repeat receptor-like protein kinase At5g63930. No verified direct reference in this release
At1g17230 Leucine-rich repeat receptor-like serine/threonine-protein kinase At1g17230. No verified direct reference in this release
At1g34110 Together with RGI1, RGI2, RGI3 and RGI4, acts as a receptor of RGF1, a peptide hormone that maintains the postembryonic root stem cell niche by regulating the expression levels and patterns of the transcription factor PLETHORA (PLT).
RGF1 INSENSITIVE 1 to 5, a group of LRR receptor-like kinases, are essential for the perception of root meristem growth factor 1 in Arabidopsis thaliana.2016 · DOI: 10.1038/cr.2016.63

Rice

No hit for this species in the current source table.

Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_000371 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)
GO:0005886 plasma membrane Cellular Component
GO:0009507 chloroplast Cellular Component
GO:0004674 protein serine/threonine kinase activity Molecular Function
GO:0004714 transmembrane receptor protein tyrosine kinase activity Molecular Function
GO:0005524 ATP binding Molecular Function
GO:0106310 protein serine kinase activity Molecular Function
KEGG gene cross-reference
ath:AT1G17230
ath:AT2G41820
ath:AT5G63930
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.870
Rank 1 · TkA01G616810 · TK1151
Endoplasmic reticulum0.086
Rank 2 · TkA01G616810 · TK1151
Cytoplasm0.060
Rank 3 · TkA01G616810 · TK1151
Nucleus0.038
Rank 4 · TkA01G616810 · TK1151
Lysosome / Vacuole0.028
Rank 5 · TkA01G616810 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF25019LRR_R13L1-DRL2126-102 aa
PF30333AllH_N26-38 aa
PF08263LRRNT_230-68 aa
PF13855LRR_841-59 aa
PF00560LRR_143-54 aa
PF13855LRR_873-131 aa
PF12799LRR_473-105 aa
PF00560LRR_174-87 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
TkA01G616810PF25019LRR_R13L1-DRL21261020.08113.5
TkA01G616810PF30333AllH_N26380.9710.1
TkA01G616810PF08263LRRNT_230680.03914.9
TkA01G616810PF13855LRR_841593.6e-2794.6
TkA01G616810PF00560LRR_143541.9e-41131.8
TkA01G616810PF13855LRR_8731313.6e-2794.6
TkA01G616810PF12799LRR_4731051.1e-1970.6
TkA01G616810PF00560LRR_174871.9e-41131.8
TkA01G616810PF23598LRR_14831981.5e-2487.1
TkA01G616810PF23211LRR_LRWD1831300.001519.0
TkA01G616810PF24141LRR_ComC882572.3e-0834.8
TkA01G616810PF29594LRR_SKP2921510.3111.0
TkA01G616810PF24758LRR_At5g56370941530.02514.9
TkA01G616810PF12799LRR_4951311.1e-1970.6
TkA01G616810PF00560LRR_1961181.9e-41131.8
TkA01G616810PF25019LRR_R13L1-DRL211021520.08113.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
O22938Arabidopsis thalianasp|O22938|PXC3_ARATH Leucine-rich repeat receptor-like tyrosine-protein kinase PXC376.300%Swiss-ProtMedium
Q9FII5Arabidopsis thalianasp|Q9FII5|TDR_ARATH Leucine-rich repeat receptor-like protein kinase TDR35.300%Swiss-ProtMedium
Q9LVP0Arabidopsis thalianasp|Q9LVP0|Y5639_ARATH Probable leucine-rich repeat receptor-like protein kinase At5g6393035.300%Swiss-ProtMedium
Q9SHI2Arabidopsis thalianasp|Q9SHI2|Y1723_ARATH Leucine-rich repeat receptor-like serine/threonine-protein kinase At1g1723035.000%Swiss-ProtMedium
C0LGF5Arabidopsis thalianasp|C0LGF5|RGI5_ARATH LRR receptor-like serine/threonine-protein kinase RGI532.800%Swiss-ProtMedium

JBrowse

View in Genome Browser