LXL04_000371 | RubberDandelionOmics

Gene overview

LXL04_000371

Reference: OH-1004 Chr: Chr01 Coordinates: 6814509-6817433 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2703 bp · LXL04_000371|LXL04_000371|OH1004|cDNA

ATGGCGAATTTGTGCTTGTTCTTGATATTGATAATTGGGGTTCTTTCATGTTGCCAAAAGCCTGCGAGTTGTCAAGTCATCGATGACGATGATGATCTTTTGACTTTGTTAGCCATTAACAAGGAGCTTAGAGTGCTCGATTGGGGGGAAAACGGACTTAAGAACAGCTCAAATTACTGCATGTGGCCTCACATTACTTGTACCTCCGATCAATCGTCTGTCGAAAAGCTTGTTCTTTCTCATCAAAGTCTACAAGGTAA...

CDS

Download CDS FASTA

2703 bp · LXL04_000371|LXL04_000371|OH1004|CDS

ATGGCGAATTTGTGCTTGTTCTTGATATTGATAATTGGGGTTCTTTCATGTTGCCAAAAGCCTGCGAGTTGTCAAGTCATCGATGACGATGATGATCTTTTGACTTTGTTAGCCATTAACAAGGAGCTTAGAGTGCTCGATTGGGGGGAAAACGGACTTAAGAACAGCTCAAATTACTGCATGTGGCCTCACATTACTTGTACCTCCGATCAATCGTCTGTCGAAAAGCTTGTTCTTTCTCATCAAAGTCTACAAGGTAA...

Protein

Download Protein FASTA

900 aa · LXL04_000371|LXL04_000371|OH1004|PROTEIN

MANLCLFLILIIGVLSCCQKPASCQVIDDDDDLLTLLAINKELRVLDWGENGLKNSSNYCMWPHITCTSDQSSVEKLVLSHQSLQGNLTLLSQLKSLKWLDLSFNTFHGSIPQSFGNLSELEFLDLSYNKFDGSIPTELGKLKNLKSLNLSNNLLMGSIPNELEGLVKLQDFQIYSNHFNGSIPIWVGNLTNLKVFTAYENELNGKIPETLGSLSELQLLNLHSNYLEGSIPTSVFTSGKLEFLVLTQNKLSGTLPEEIG...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_000371`
TK1151 ID	TkA01G616810
OH-1004 ID	LXL04_000371
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.700
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_000371

Location Chr01:6814509-6817433 (+)

Description Similar to PXC3: Leucine-rich repeat receptor-like tyrosine-protein kinase PXC3

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g41820`	Leucine-rich repeat receptor-like protein kinase that may play a role in vascular tissues development.	No verified direct reference in this release
`At5g63930`	Probable leucine-rich repeat receptor-like protein kinase At5g63930.	No verified direct reference in this release
`At1g17230`	Leucine-rich repeat receptor-like serine/threonine-protein kinase At1g17230.	No verified direct reference in this release
`At2g33170`	Probable leucine-rich repeat receptor-like protein kinase At2g33170.	No verified direct reference in this release
`At5g48940`	Together with RGI1, RGI3, RGI4 and RGI5, acts as a receptor of RGF peptides (e.g. RGF1, GLV5/CLEL1/RGF2, GLV7/CLEL3/RGF3, GLV3/RGF4, GLV10/CLEL7/RGF5 and RGF10/CLELN), peptide hormones which maintain the postembryonic root stem cell niche by regulating the expression levels and patterns of the transcription factor PLETHORA (PLT, e.g. PLT1 and PLT2).	RGF1 INSENSITIVE 1 to 5, a group of LRR receptor-like kinases, are essential for the perception of root meristem growth factor 1 in Arabidopsis thaliana.2016 · DOI: 10.1038/cr.2016.63

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_000371 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0005886 plasma membrane Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0004674 protein serine/threonine kinase activity Molecular Function

GO:0004714 transmembrane receptor protein tyrosine kinase activity Molecular Function

GO:0005524 ATP binding Molecular Function

GO:0106310 protein serine kinase activity Molecular Function

KEGG gene cross-reference

ath:AT1G17230

ath:AT2G41820

ath:AT5G63930

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.870

Rank 1 · LXL04_000371 · OH-1004

Endoplasmic reticulum0.087

Rank 2 · LXL04_000371 · OH-1004

Cytoplasm0.060

Rank 3 · LXL04_000371 · OH-1004

Nucleus0.038

Rank 4 · LXL04_000371 · OH-1004

Lysosome / Vacuole0.028

Rank 5 · LXL04_000371 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF13855.13LRR_873-131 aa

PF23598.2LRR_1483-198 aa

PF12799.14LRR_4120-155 aa

PF13855.13LRR_8141-179 aa

PF23598.2LRR_14187-269 aa

PF13855.13LRR_8295-347 aa

PF13855.13LRR_8335-395 aa

PF00069.32Pkinase620-829 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_000371	`PF13855.13`	LRR_8	73	131	3.5e-27	94.6
LXL04_000371	`PF23598.2`	LRR_14	83	198	1.7e-24	87.0
LXL04_000371	`PF12799.14`	LRR_4	120	155	5.6e-20	71.6
LXL04_000371	`PF13855.13`	LRR_8	141	179	3.5e-27	94.6
LXL04_000371	`PF23598.2`	LRR_14	187	269	1.7e-24	87.0
LXL04_000371	`PF13855.13`	LRR_8	295	347	3.5e-27	94.6
LXL04_000371	`PF13855.13`	LRR_8	335	395	3.5e-27	94.6
LXL04_000371	`PF00069.32`	Pkinase	620	829	4.5e-24	86.0
LXL04_000371	`PF07714.24`	PK_Tyr_Ser-Thr	621	893	1.3e-26	94.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O22938`	Arabidopsis thaliana	Leucine-rich repeat receptor-like tyrosine-protein kinase PXC3	67.925%	Swiss-Prot	strong database homology
`Q9LVP0`	Arabidopsis thaliana	Probable leucine-rich repeat receptor-like protein kinase At5g63930	37.292%	Swiss-Prot	moderate database homology
`Q9SHI2`	Arabidopsis thaliana	Leucine-rich repeat receptor-like serine/threonine-protein kinase At1g17230	36.943%	Swiss-Prot	moderate database homology
`O49318`	Arabidopsis thaliana	Probable leucine-rich repeat receptor-like protein kinase At2g33170	36.600%	Swiss-Prot	moderate database homology
`C0LGV1`	Arabidopsis thaliana	LRR receptor-like serine/threonine-protein kinase RGI2	35.844%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card